[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : citR
DDBJ      :citR         transcriptional regulator CitR (LysR family)
Swiss-Prot:CITR_BACSU   RecName: Full=HTH-type transcriptional regulator citR;AltName: Full=Citrate synthase I repressor;

Homologs  Archaea  9/68 : Bacteria  713/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:291 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->286 3hhgG PDBj 1e-10 24.6 %
:RPS:PDB   1->212 1b9nB PDBj 3e-25 10.3 %
:RPS:SCOP  1->104 1b9mA1  a.4.5.8 * 1e-21 16.3 %
:RPS:SCOP  87->257 1i69A  c.94.1.1 * 1e-19 19.4 %
:HMM:SCOP  1->89 1ixcA1 a.4.5.37 * 2.4e-24 39.3 %
:HMM:SCOP  82->291 1uthA_ c.94.1.1 * 3.5e-24 21.5 %
:RPS:PFM   6->61 PF00126 * HTH_1 2e-09 46.4 %
:RPS:PFM   92->264 PF03466 * LysR_substrate 6e-13 25.4 %
:HMM:PFM   87->288 PF03466 * LysR_substrate 2.3e-32 23.6 199/209  
:HMM:PFM   4->62 PF00126 * HTH_1 2.9e-21 45.8 59/60  
:BLT:SWISS 1->291 CITR_BACSU e-168 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12782.2 GT:GENE citR GT:PRODUCT transcriptional regulator CitR (LysR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1020073..1020948) GB:FROM 1020073 GB:TO 1020948 GB:DIRECTION - GB:GENE citR GB:PRODUCT transcriptional regulator CitR (LysR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 8045899; Product type r : regulator GB:PROTEIN_ID CAB12782.2 GB:DB_XREF GOA:P39127 InterPro:IPR011991 SubtiList:BG10853 UniProtKB/Swiss-Prot:P39127 GB:GENE:GENE citR LENGTH 291 SQ:AASEQ MDFKWLHTFVTAAKYENFRKTAETLFLSQPTVTVHIKQLEKEISCKLFERKGRQIQLTDEGRAYLPYALRLLDDYENSMAELHRVRQGYSQTLQLAVSPLIADTVLPSVMKRYTAMNTETEMAVTIFESAEIASLIKAGEADIGLSCLKVQSSSLSCHCLYKDPVVLVAPPDKRFIEDNEIDAKEVLEQYLLLTHNHPDYWDDLLRQVRMTFPFVRTMKVTQTHITKRFIKEGLGVSFLPLSTVKRELAEKQMIRIPYQSVQLPYAGAYAIALYENKKEKKFLDFLSHFHF GT:EXON 1|1-291:0| SW:ID CITR_BACSU SW:DE RecName: Full=HTH-type transcriptional regulator citR;AltName: Full=Citrate synthase I repressor; SW:GN Name=citR; OrderedLocusNames=BSU09430; SW:KW Complete proteome; Cytoplasm; DNA-binding; Repressor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->291|CITR_BACSU|e-168|100.0|291/291| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| BL:PDB:NREP 1 BL:PDB:REP 6->286|3hhgG|1e-10|24.6|268/294| RP:PDB:NREP 1 RP:PDB:REP 1->212|1b9nB|3e-25|10.3|204/245| RP:PFM:NREP 2 RP:PFM:REP 6->61|PF00126|2e-09|46.4|56/60|HTH_1| RP:PFM:REP 92->264|PF03466|6e-13|25.4|173/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 87->288|PF03466|2.3e-32|23.6|199/209|LysR_substrate| HM:PFM:REP 4->62|PF00126|2.9e-21|45.8|59/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->104|1b9mA1|1e-21|16.3|104/122|a.4.5.8| RP:SCP:REP 87->257|1i69A|1e-19|19.4|165/206|c.94.1.1| HM:SCP:REP 1->89|1ixcA1|2.4e-24|39.3|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->291|1uthA_|3.5e-24|21.5|209/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 5008 OP:NHOMOORG 730 OP:PATTERN -----------------------------------11111111----------1-------------- 344-61-244421174311-131129111112511136CD-31711111111244--2--23--2297853-111---11364211112221-211---11711151215---------------1---1----1-13321---314223444223311111113286452111111111111221-----63DAAAAAABA499ABC991CBEEA9B243C352466464MY14465664665546673439221511521216822223411143222221----11-----------111111--11111---111---3-54DA6666786364294442229311265421BC551211622121-111213111-----14C87224485646665647656C-24635F498A2-IBB88B9FKEA9GB4-355C42462755555555525454214------------------------------146-29WOGRVWYcaZGFEFDUUWZHGHHAGfLaUWSX-2NJE46777NBN3N97A9532182333341444364842211241139223-323536431331354131-21------1----------1-2165C7A765C-66637776455B896D6676AB---2327------F7CB6A8IHGGIGEEHH-HHGHKEEGHGHGHGGHHGBKNICC367H7GEFGHGHGIEHEEEGCD9CCCC4-943545344545---412111232232BCM3532--222121113EEEEF9C386G2LNKMPMMQAPSQN7IIN22211222249EEEABAABAEDDC66477773431111--3-22------------1-------------------------------------241 -------------1------------------------------------------------------------------------------------------------------------------------------------------------6------1----5----1---------1--5-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 98.3 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHHHTTTTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTcEEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEGGGcTTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGcHcTTTcTTcEEEETTcccEEEEEEEETTccccHHHHHHHHHH##### PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEccccccHHHHHHHHHcccccccEEEEEccHHHHHHHHHccccEEEHHHHHHHHHHccccEEEEccccccEEEEEEEEccccccHHHHHHHHHHHHccc //