[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : comC
DDBJ      :comC         membrane protease and transmethylase
Swiss-Prot:LEP4_BACSU   RecName: Full=Type 4 prepilin-like proteins leader peptide-processing enzyme;AltName: Full=Late competence protein comC;Includes:  RecName: Full=Leader peptidase;           EC=3.4.23.43;  AltName: Full=Prepilin peptidase;Includes:  RecName: Full=N-methyltransferase;           EC=2.1.1.-;

Homologs  Archaea  0/68 : Bacteria  270/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
g.44.1
:248 amino acids
:PSIPRED
:RPS:SCOP  17->67 1jm7A  g.44.1.1 * 2e-05 22.0 %
:RPS:PFM   24->93 PF06750 * DiS_P_DiS 2e-11 42.9 %
:HMM:PFM   7->91 PF06750 * DiS_P_DiS 1.2e-29 45.9 85/92  
:HMM:PFM   101->203 PF01478 * Peptidase_A24 1e-17 30.1 103/106  
:BLT:SWISS 16->248 LEP4_BACSU e-119 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14767.2 GT:GENE comC GT:PRODUCT membrane protease and transmethylase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2864426..2865172) GB:FROM 2864426 GB:TO 2865172 GB:DIRECTION - GB:GENE comC GB:PRODUCT membrane protease and transmethylase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16751195, 16850406, 2553669, 9723928; Product type cp: cell process GB:PROTEIN_ID CAB14767.2 GB:DB_XREF GOA:P15378 InterPro:IPR000045 SubtiList:BG10323 UniProtKB/Swiss-Prot:P15378 GB:GENE:GENE comC LENGTH 248 SQ:AASEQ MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGKCKSCGHRISFMYPAAELVTACLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIPNRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVIAAITHGGVGGGDIKLFAVIGFVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIISFYIKMALG GT:EXON 1|1-248:0| SW:ID LEP4_BACSU SW:DE RecName: Full=Type 4 prepilin-like proteins leader peptide-processing enzyme;AltName: Full=Late competence protein comC;Includes: RecName: Full=Leader peptidase; EC=3.4.23.43; AltName: Full=Prepilin peptidase;Includes: RecName: Full=N-methyltransferase; EC=2.1.1.-; SW:GN Name=comC; OrderedLocusNames=BSU28070; SW:KW Cell membrane; Competence; Complete proteome; Hydrolase; Membrane;Methyltransferase; Multifunctional enzyme; Protease; Sporulation;Transferase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 16->248|LEP4_BACSU|e-119|100.0|233/248| GO:SWS:NREP 10 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0030420|"GO:establishment of competence for transformation"|Competence| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 1->23| TM:REGION 83->105| TM:REGION 117->139| TM:REGION 143->165| TM:REGION 180->202| TM:REGION 222->244| SEG 2->15|lsilfifglilgsf| SEG 145->163|agllgaaagflflaviaai| RP:PFM:NREP 1 RP:PFM:REP 24->93|PF06750|2e-11|42.9|70/95|DiS_P_DiS| HM:PFM:NREP 2 HM:PFM:REP 7->91|PF06750|1.2e-29|45.9|85/92|DiS_P_DiS| HM:PFM:REP 101->203|PF01478|1e-17|30.1|103/106|Peptidase_A24| RP:SCP:NREP 1 RP:SCP:REP 17->67|1jm7A|2e-05|22.0|50/103|g.44.1.1| OP:NHOMO 274 OP:NHOMOORG 272 OP:PATTERN -------------------------------------------------------------------- 111-------------------------------------1---1---1-------------1-----------------1--11111-----------------------------------------------------111--11111111111------111-1111----1-1---1---11111-11111111111111111111111111111111111--111-1-------------------------------------1------------------------------------------1---------111-1111-1111-1111111111111---11111211-1-1111111--11-----------------------------------------------------------------------------------------------------------------------1-----------------------1----------1111--111-1111----1-1-1-111--11111111111111111111--11111-111111111----1-11-1------------------1111111-111-111-11-11111111111-1-1111--111-1--------------11--------1---------1------------111------------------------------------------1111111---11------------------1111111111-1--1----211111-1111----1---1-111-------11-----------1111--1------------------------------------------------1-1-1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //