[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : comGG
DDBJ      :comGG        component of the DNA transport platform
Swiss-Prot:COMGG_BACSU  RecName: Full=ComG operon protein 7;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->124 COMGG_BACSU 1e-67 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14398.1 GT:GENE comGG GT:PRODUCT component of the DNA transport platform GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2556137..2556511) GB:FROM 2556137 GB:TO 2556511 GB:DIRECTION - GB:GENE comGG GB:PRODUCT component of the DNA transport platform GB:FUNCTION 16.11: Scavenge (Catabolism) 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15849754, 16850406, 9150204, 9723928; Product type cp: cell process GB:PROTEIN_ID CAB14398.1 GB:DB_XREF GOA:P25959 SubtiList:BG10489 UniProtKB/Swiss-Prot:P25959 GB:GENE:GENE comGG LENGTH 124 SQ:AASEQ MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVSYYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE GT:EXON 1|1-124:0| SW:ID COMGG_BACSU SW:DE RecName: Full=ComG operon protein 7;Flags: Precursor; SW:GN Name=comGG; Synonyms=comG7; OrderedLocusNames=BSU24670; SW:KW Cell membrane; Competence; Complete proteome; Disulfide bond;Membrane; Peptidoglycan-anchor; Secreted; Signal; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->124|COMGG_BACSU|1e-67|100.0|124/100| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0030420|"GO:establishment of competence for transformation"|Competence| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 1 TM:REGION 7->29| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 63-72, 123-124| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEccHHHHHHHEEEEEEEEcccccEEEEEEEEHHHcHHccccc //