[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : comX
DDBJ      :comX         competence pheromone precursor (pheromone peptide aa 46->55, modified)
Swiss-Prot:COMX1_BACSU  RecName: Full=Competence pheromone;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->40 PF05952 * ComX 5e-09 57.5 %
:HMM:PFM   1->54 PF05952 * ComX 1.4e-26 40.7 54/57  
:BLT:SWISS 1->55 COMX1_BACSU 1e-29 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15158.1 GT:GENE comX GT:PRODUCT competence pheromone precursor (pheromone peptide aa 46->55, modified) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3255853..3256020) GB:FROM 3255853 GB:TO 3256020 GB:DIRECTION - GB:GENE comX GB:PRODUCT competence pheromone precursor (pheromone peptide aa 46->55, modified) GB:FUNCTION 16.12: Sense 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11751817, 12067344, 14679219, 16407988, 17240141, 18323630; Product type f : factor GB:PROTEIN_ID CAB15158.1 GB:DB_XREF GOA:P45453 InterPro:IPR009233 SubtiList:BG11324 UniProtKB/Swiss-Prot:P45453 GB:GENE:GENE comX LENGTH 55 SQ:AASEQ MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD GT:EXON 1|1-55:0| SW:ID COMX1_BACSU SW:DE RecName: Full=Competence pheromone;Flags: Precursor; SW:GN Name=comX; OrderedLocusNames=BSU31700; SW:KW Competence; Complete proteome; Direct protein sequencing; Lipoprotein;Pheromone; Prenylation; Secreted; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->55|COMX1_BACSU|1e-29|100.0|55/55| GO:SWS:NREP 4 GO:SWS GO:0030420|"GO:establishment of competence for transformation"|Competence| GO:SWS GO:0005186|"GO:pheromone activity"|Pheromone| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| RP:PFM:NREP 1 RP:PFM:REP 1->40|PF05952|5e-09|57.5|40/53|ComX| HM:PFM:NREP 1 HM:PFM:REP 1->54|PF05952|1.4e-26|40.7|54/57|ComX| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-55| PSIPRED cHHHHHHHHccHHHHHHHHccccEEEEEccccccEEEEccccEEccccccccccc //