[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : copZ
DDBJ      :copZ         copper insertion chaperone and transporter component
Swiss-Prot:COPZ_BACSU   RecName: Full=Copper chaperone copZ;AltName: Full=Copper-ion-binding protein;

Homologs  Archaea  15/68 : Bacteria  121/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:69 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->69 2qifA PDBj 2e-35 100.0 %
:RPS:PDB   1->67 1afiA PDBj 5e-15 35.8 %
:RPS:SCOP  1->69 2qifA1  d.58.17.1 * 5e-15 100.0 %
:HMM:SCOP  1->67 1k0vA_ d.58.17.1 * 1.3e-19 44.8 %
:RPS:PFM   6->65 PF00403 * HMA 7e-07 43.3 %
:HMM:PFM   5->66 PF00403 * HMA 7e-21 35.5 62/62  
:BLT:SWISS 1->69 COPZ_BACSU 2e-35 100.0 %
:PROS 8->37|PS01047|HMA_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15356.1 GT:GENE copZ GT:PRODUCT copper insertion chaperone and transporter component GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3443613..3443822) GB:FROM 3443613 GB:TO 3443822 GB:DIRECTION - GB:GENE copZ GB:PRODUCT copper insertion chaperone and transporter component GB:FUNCTION 16.6: Maintain 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11934502, 12238948, 12590580, 14621987, 14663075, 15212800, 18419582; Product type f: factor GB:PROTEIN_ID CAB15356.1 GB:DB_XREF GOA:O32221 InterPro:IPR006121 PDB:1K0V SubtiList:BG14107 UniProtKB/Swiss-Prot:O32221 GB:GENE:GENE copZ LENGTH 69 SQ:AASEQ MEQKTLQVEGMSCQHCVKAVETSVGELDGVSAVHVNLEAGKVDVSFDADKVSVKDIADAIEDQGYDVAK GT:EXON 1|1-69:0| SW:ID COPZ_BACSU SW:DE RecName: Full=Copper chaperone copZ;AltName: Full=Copper-ion-binding protein; SW:GN Name=copZ; Synonyms=yvgY; OrderedLocusNames=BSU33510; SW:KW 3D-structure; Chaperone; Complete proteome; Copper; Cytoplasm;Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->69|COPZ_BACSU|2e-35|100.0|69/69| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 8->37|PS01047|HMA_1|PDOC00804| BL:PDB:NREP 1 BL:PDB:REP 1->69|2qifA|2e-35|100.0|69/69| RP:PDB:NREP 1 RP:PDB:REP 1->67|1afiA|5e-15|35.8|67/72| RP:PFM:NREP 1 RP:PFM:REP 6->65|PF00403|7e-07|43.3|60/62|HMA| HM:PFM:NREP 1 HM:PFM:REP 5->66|PF00403|7e-21|35.5|62/62|HMA| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF00403|IPR006121| GO:PFM GO:0046872|"GO:metal ion binding"|PF00403|IPR006121| RP:SCP:NREP 1 RP:SCP:REP 1->69|2qifA1|5e-15|100.0|69/69|d.58.17.1| HM:SCP:REP 1->67|1k0vA_|1.3e-19|44.8|67/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 179 OP:NHOMOORG 148 OP:PATTERN -----------------------12-------111---11---------1232--1--111------- --------11-----------------------111------------------------11-1-1------------------1-----------------------------------------------------------------------------------1-----------------------21111-112111121111111111112121--111111111-111111-11111111111111--------1---------------------------------------------------111111111-11-111111111111---111--1-----1-1-1--1-111312----1--------------------------------------------------------------------------------------1--------------------------------------1---------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---234---1---------1------------------------------------------------------------1----------------2--------------------------1----------- ------------111--------------------------------------------------------1-------------------------------1-----------2-----------------------------------------1-12A--1-------1-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcTTcccccHHHHHHHHHHTTccEEEEEEETTTTEEEEEEcTTTccHHHHHHHHHHHTcccTT DISOP:02AL 67-69| PSIPRED ccEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEEccccccHHHHHHHHHHccccccc //