[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cotB
DDBJ      :cotB         spore coat protein (outer)
Swiss-Prot:COTB_BACSU   RecName: Full=Spore coat protein B;

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:380 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->69 PF10842 * DUF2642 7e-05 30.3 33/66  
:HMM:PFM   230->351 PF04652 * DUF605 3.5e-05 19.7 122/383  
:HMM:PFM   360->368 PF00414 * MAP1B_neuraxin 0.00037 55.6 9/17  
:BLT:SWISS 1->252,361->380 COTB_BACSU e-122 100.0 %
:REPEAT 3|32->70|107->146|184->222
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15622.1 GT:GENE cotB GT:PRODUCT spore coat protein (outer) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3714739..3715881) GB:FROM 3714739 GB:TO 3715881 GB:DIRECTION - GB:GENE cotB GB:PRODUCT spore coat protein (outer) GB:FUNCTION 16.8: Protect 16.13: Shape 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10559171, 11737650, 14762006, 8755863; Product type f: factor GB:PROTEIN_ID CAB15622.1 GB:DB_XREF GOA:P07789 SubtiList:BG10491 UniProtKB/Swiss-Prot:P07789 GB:GENE:GENE cotB LENGTH 380 SQ:AASEQ MSKRRMKYHSNNEISYYNFLHSMKDKIVTVYRGGPESKKGKLTAVKSDYIALQAEKKIIYYQLEHVKSITEDTNNSTTTIETEEMLDADDFHSLIGHLINQSVQFNQGGPESKKGRLVWLGDDYAALNTNEDGVVYFNIHHIKSISKHEPDLKIEEQTPVGVLEADDLSEVFKSLTHKWVSINRGGPEAIEGILVDNADGHYTIVKNQEVLRIYPFHIKSISLGPKGSYKKEDQKNEQNQEDNNDKDSNSFISSKSYSSSKSSKRSLKSSDDQSSKSGRSSRSKSSSKSSKRSLKSSDYQSSKSGRSSRSKSSSKSSKRSLKSSDYQSSKSSKRSPRSSDYQSSRSPGYSSSIKSSGKQKEDYSYETIVRTIDYHWKRKF GT:EXON 1|1-380:0| SW:ID COTB_BACSU SW:DE RecName: Full=Spore coat protein B; SW:GN Name=cotB; OrderedLocusNames=BSU36050; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->252,361->380|COTB_BACSU|e-122|100.0|272/380| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| NREPEAT 1 REPEAT 3|32->70|107->146|184->222| SEG 68->84|sitedtnnstttietee| SEG 230->247|kkedqkneqnqednndkd| SEG 253->360|ssksysssksskrslkssddqssksgrssrsksssksskrslkssdyqssksgrssrsksssksskrslkssdyqssksskrsprssdyqssrspgysssikssgkqk| HM:PFM:NREP 3 HM:PFM:REP 37->69|PF10842|7e-05|30.3|33/66|DUF2642| HM:PFM:REP 230->351|PF04652|3.5e-05|19.7|122/383|DUF605| HM:PFM:REP 360->368|PF00414|0.00037|55.6|9/17|MAP1B_neuraxin| OP:NHOMO 32 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--2222-2-222221-----1212111-----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 219-369| PSIPRED cccccccccccccccHHHHHHHHcccEEEEEEccccEEEEEEEEEEccEEEEEcccEEEEEEHHHEEEEccccccccccccccccccHHHHHHHHHHHHccEEEEEccccccEEEEEEEEcccEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHcccEEEEEEcccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHHHccccHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHccccccccHHHHHHHHHHHHHcccc //