[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cotD
DDBJ      :cotD         spore coat protein (inner)
Swiss-Prot:COTD_BACSU   RecName: Full=Spore coat protein D;

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->59 PF11122 * Spore-coat_CotD 2e-08 59.2 %
:HMM:PFM   10->69 PF11122 * Spore-coat_CotD 1.6e-27 58.3 60/92  
:BLT:SWISS 1->75 COTD_BACSU 5e-49 100.0 %
:REPEAT 2|2->17|21->36
:REPEAT 2|37->46|55->67

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14137.1 GT:GENE cotD GT:PRODUCT spore coat protein (inner) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2332784..2333011) GB:FROM 2332784 GB:TO 2333011 GB:DIRECTION - GB:GENE cotD GB:PRODUCT spore coat protein (inner) GB:FUNCTION 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10075739, 10400595, 1518043, 1691789, 2821284; Product type cp: cell process GB:PROTEIN_ID CAB14137.1 GB:DB_XREF GOA:P07791 SubtiList:BG10493 UniProtKB/Swiss-Prot:P07791 GB:GENE:GENE cotD LENGTH 75 SQ:AASEQ MHHCRPHMMAPIVHPTHCCEHHTFSKTIVPHIHPQHTTNVNHQHFQHVHYFPHTFSNVDPATHQHFQAGKPCCDY GT:EXON 1|1-75:0| SW:ID COTD_BACSU SW:DE RecName: Full=Spore coat protein D; SW:GN Name=cotD; OrderedLocusNames=BSU22200; SW:KW Complete proteome; Sporulation. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|COTD_BACSU|5e-49|100.0|75/100| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| NREPEAT 2 REPEAT 2|2->17|21->36| REPEAT 2|37->46|55->67| RP:PFM:NREP 1 RP:PFM:REP 11->59|PF11122|2e-08|59.2|49/112|Spore-coat_CotD| HM:PFM:NREP 1 HM:PFM:REP 10->69|PF11122|1.6e-27|58.3|60/92|Spore-coat_CotD| OP:NHOMO 28 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-111111-124-11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 74-75| PSIPRED cccccccccccEEcccccccccEEccEEccccccccccccccEEEEEEEccccEEccccccccccEEcccccccc //