[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cotF
DDBJ      :cotF         spore coat protein
Swiss-Prot:COTF_BACSU   RecName: Full=Spore coat protein F;Contains:  RecName: Full=5 kDa coat protein;Contains:  RecName: Full=8 kDa coat protein;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   83->140 PF07875 * Coat_F 8e-14 62.1 %
:HMM:PFM   83->141 PF07875 * Coat_F 7.9e-28 49.2 59/64  
:HMM:PFM   21->63 PF09537 * DUF2383 0.00039 27.9 43/111  
:BLT:SWISS 1->160 COTF_BACSU 2e-90 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16090.1 GT:GENE cotF GT:PRODUCT spore coat protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4167110..4167592 GB:FROM 4167110 GB:TO 4167592 GB:DIRECTION + GB:GENE cotF GB:PRODUCT spore coat protein GB:FUNCTION 16.8: Protect 16.13: Shape GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 1708381; Product type f : factor GB:PROTEIN_ID CAB16090.1 GB:DB_XREF GOA:P23261 InterPro:IPR012851 SubtiList:BG10012 UniProtKB/Swiss-Prot:P23261 GB:GENE:GENE cotF LENGTH 160 SQ:AASEQ MDERRTLAWHETLEMHELVAFQSNGLIKLKKMIREVKDPQLRQLYNVSIQGVEQNLRELLPFFPQAPHREDEEEERADNPFYSGDLLGFAKTSVRSYAIAITETATPQLRNVLVKQLNAAIQLHAQVYRYMYQHGYYPSYNLSELLKNDVRNANRAISMK GT:EXON 1|1-160:0| SW:ID COTF_BACSU SW:DE RecName: Full=Spore coat protein F;Contains: RecName: Full=5 kDa coat protein;Contains: RecName: Full=8 kDa coat protein;Flags: Precursor; SW:GN Name=cotF; OrderedLocusNames=BSU40530; SW:KW Complete proteome; Direct protein sequencing; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->160|COTF_BACSU|2e-90|100.0|160/160| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| RP:PFM:NREP 1 RP:PFM:REP 83->140|PF07875|8e-14|62.1|58/64|Coat_F| HM:PFM:NREP 2 HM:PFM:REP 83->141|PF07875|7.9e-28|49.2|59/64|Coat_F| HM:PFM:REP 21->63|PF09537|0.00039|27.9|43/111|DUF2383| OP:NHOMO 26 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211111--1-111--1-122-211--21----------1----------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 65-78, 158-160| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccc //