[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cotG
DDBJ      :cotG         spore morphogenetic protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 1->31,171->195 COTG_BACSU 3e-14 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15624.1 GT:GENE cotG GT:PRODUCT spore morphogenetic protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3717238..3717825 GB:FROM 3717238 GB:TO 3717825 GB:DIRECTION + GB:GENE cotG GB:PRODUCT spore morphogenetic protein GB:FUNCTION 16.13: Shape 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11737650, 14762006, 15621419; Product type cp: cell process GB:PROTEIN_ID CAB15624.1 GB:DB_XREF GOA:P39801 SubtiList:BG11017 UniProtKB/Swiss-Prot:P39801 GB:GENE:GENE cotG LENGTH 195 SQ:AASEQ MGHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSHKKSHRTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKYYKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 1->31,171->195|COTG_BACSU|3e-14|100.0|56/100| SEG 32->146|kkrshkkshrthkksrshkksycshkksrshkksfcshkksrshkksycshkksrshkksyrshkksrsykksyrsykksrsykkscrsykksrsykksycshkkksrsykkscr| SEG 148->170|hkksyrshkkyykkphhhcddyk| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-12, 14-15, 25-156| PSIPRED cccccHHHHHHHHHHHHHccHHHHHEEccccccccEEEEcccHHHEEcccccccccEEEEcEEEEEcccEEEEccccEEcccccccccEEEEEEccEEEEEEEcccccEEEEccccEEEccEEEcccEEEEEcccEEEEEEEEEEEEEEEcccccEEEEEcccccccccccccccccHHHHcccccEEEEEEccc //