[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : csbX
DDBJ      :csbX         putative permease
Swiss-Prot:CSBX_BACSU   RecName: Full=Alpha-ketoglutarate permease;

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:435 amino acids
:SECSTR
:PSIPRED
:RPS:SCOP  25->390 1pw4A  f.38.1.1 * 1e-08 14.0 %
:HMM:SCOP  1->405 1pw4A_ f.38.1.1 * 4.6e-48 22.0 %
:RPS:PFM   35->366 PF07690 * MFS_1 3e-05 31.6 %
:HMM:PFM   39->293 PF07690 * MFS_1 5.4e-23 21.2 250/353  
:HMM:PFM   237->410 PF07690 * MFS_1 7.5e-17 25.3 166/353  
:BLT:SWISS 1->435 CSBX_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14736.2 GT:GENE csbX GT:PRODUCT putative permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2837469..2838776) GB:FROM 2837469 GB:TO 2838776 GB:DIRECTION - GB:GENE csbX GB:PRODUCT putative permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 15849754, 16850406, 9099855; Product type pt: putative transporter GB:PROTEIN_ID CAB14736.2 GB:DB_XREF GOA:O05390 InterPro:IPR004748 SubtiList:BG11922 UniProtKB/Swiss-Prot:O05390 GB:GENE:GENE csbX LENGTH 435 SQ:AASEQ MNTVHAKGNVLNKIGIPSHMVWGYIGVVIFMVGDGLEQGWLSPFLVDHGLSMQQSASLFTMYGIAVTISAWLSGTFVQTWGPRKTMTVGLLAFILGSAAFIGWAIPHMYYPALLGSYALRGLGYPLFAYSFLVWVSYSTSQNILGKAVGWFWFMFTCGLNVLGPFYSSYAVPAFGEINTLWSALLFVAAGGILALFFNKDKFTPIQKQDQPKWKELSKAFTIMFENPKVGIGGVVKTINAIGQFGFAIFLPTYLARYGYSVSEWLQIWGTLFFVNIVFNIIFGAVGDKLGWRNTVMWFGGVGCGIFTLALYYTPQLIGHQYWVLMIIACCYGAALAGYVPLSALLPTLAPDNKGAAMSVLNLGSGLCAFIAPGIVSLFIGPLGAGGVIWIFAALYFFSAFLTRFLTISEQSTDVYTEERFVRENVQTNFDKTVKQ GT:EXON 1|1-435:0| SW:ID CSBX_BACSU SW:DE RecName: Full=Alpha-ketoglutarate permease; SW:GN Name=csbX; OrderedLocusNames=BSU27760; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->435|CSBX_BACSU|0.0|100.0|435/435| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 11 TM:REGION 15->37| TM:REGION 57->79| TM:REGION 87->109| TM:REGION 143->165| TM:REGION 178->199| TM:REGION 237->259| TM:REGION 267->289| TM:REGION 294->316| TM:REGION 325->347| TM:REGION 356->378| TM:REGION 385->407| SEG 272->282|ffvnivfniif| RP:PFM:NREP 1 RP:PFM:REP 35->366|PF07690|3e-05|31.6|304/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 39->293|PF07690|5.4e-23|21.2|250/353|MFS_1| HM:PFM:REP 237->410|PF07690|7.5e-17|25.3|166/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 25->390|1pw4A|1e-08|14.0|364/434|f.38.1.1| HM:SCP:REP 1->405|1pw4A_|4.6e-48|22.0|400/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 66 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- --------111-----------------------------------1------------------13----1----2------------------------------1-1-----------------------------------------------------------------------------------111111--2-1-1---1----211-------------------------------2--13----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111-111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------1-1-1------------------11-----------2212---1-1--------11-1--1-----------------------------------------------------------------2-----------------1------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 57.7 SQ:SECSTR ##########################################HHTTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHH#HHHHTHHHHHHHHHTTcTTTHHHHHHH########HHHHHHHHHHTcHHHHHHHHHHHTcccTTcTHHHHHHHHHHHHHTTTcccccTTTcccccTHHHHHHTc##ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHH################HHHHHHHTcTTcHHHHHHHHHHHHHHHHH###TTc################################################################################################################ PSIPRED cccccccccHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHEEEcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHccEEEcccccEEEEEEEHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHcc //