[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : csgA
DDBJ      :csgA         sporulation-specific SASP protein
Swiss-Prot:CSGA_BACSU   RecName: Full=Sigma-G-dependent sporulation-specific SASP protein;

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->76 PF10187 * Nefa_Nip30_N 0.00086 30.6 36/102  
:BLT:SWISS 1->82 CSGA_BACSU 5e-44 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12001.1 GT:GENE csgA GT:PRODUCT sporulation-specific SASP protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 228066..228314 GB:FROM 228066 GB:TO 228314 GB:DIRECTION + GB:GENE csgA GB:PRODUCT sporulation-specific SASP protein GB:FUNCTION 16.5: Explore GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 9016963; Product type cp: cell process GB:PROTEIN_ID CAB12001.1 GB:DB_XREF GOA:P54379 SubtiList:BG11504 UniProtKB/Swiss-Prot:P54379 GB:GENE:GENE csgA LENGTH 82 SQ:AASEQ MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDDNEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL GT:EXON 1|1-82:0| SW:ID CSGA_BACSU SW:DE RecName: Full=Sigma-G-dependent sporulation-specific SASP protein; SW:GN Name=csgA; OrderedLocusNames=BSU02070; SW:KW Complete proteome; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->82|CSGA_BACSU|5e-44|100.0|82/82| GO:SWS:NREP 1 GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| HM:PFM:NREP 1 HM:PFM:REP 40->76|PF10187|0.00086|30.6|36/102|Nefa_Nip30_N| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------11-1---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHc //