[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cspB
DDBJ      :cspB         major cold-shock protein, RNA helicase co-factor, RNA co-chaperone
Swiss-Prot:CSPB_BACSU   RecName: Full=Cold shock protein cspB;AltName: Full=Major cold shock protein;

Homologs  Archaea  10/68 : Bacteria  694/915 : Eukaryota  68/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->67 2es2A PDBj 2e-35 100.0 %
:RPS:PDB   1->65 1c9oA PDBj 4e-21 84.6 %
:RPS:SCOP  1->65 1c9oA  b.40.4.5 * 2e-21 84.6 %
:HMM:SCOP  1->67 2es2A1 b.40.4.5 * 1e-24 56.7 %
:RPS:PFM   4->64 PF00313 * CSD 5e-17 72.1 %
:HMM:PFM   1->65 PF00313 * CSD 3.9e-34 64.6 65/67  
:BLT:SWISS 1->67 CSPB_BACSU 2e-35 100.0 %
:PROS 15->33|PS00352|COLD_SHOCK

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12738.1 GT:GENE cspB GT:PRODUCT major cold-shock protein, RNA helicase co-factor, RNA co-chaperone GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(984262..984465) GB:FROM 984262 GB:TO 984465 GB:DIRECTION - GB:GENE cspB GB:PRODUCT major cold-shock protein, RNA helicase co-factor, RNA co-chaperone GB:FUNCTION 16.8: Protect GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12493834, 16352840; Product type f: factor GB:PROTEIN_ID CAB12738.1 GB:DB_XREF GOA:P32081 InterPro:IPR012340 PDB:1CSP SubtiList:BG10824 UniProtKB/Swiss-Prot:P32081 GB:GENE:GENE cspB LENGTH 67 SQ:AASEQ MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA GT:EXON 1|1-67:0| SW:ID CSPB_BACSU SW:DE RecName: Full=Cold shock protein cspB;AltName: Full=Major cold shock protein; SW:GN Name=cspB; Synonyms=cspA; OrderedLocusNames=BSU09100; SW:KW 3D-structure; Activator; Complete proteome; Cytoplasm;Direct protein sequencing; DNA-binding; Stress response;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->67|CSPB_BACSU|2e-35|100.0|67/67| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006950|"GO:response to stress"|Stress response| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 15->33|PS00352|COLD_SHOCK|PDOC00304| BL:PDB:NREP 1 BL:PDB:REP 1->67|2es2A|2e-35|100.0|67/67| RP:PDB:NREP 1 RP:PDB:REP 1->65|1c9oA|4e-21|84.6|65/66| RP:PFM:NREP 1 RP:PFM:REP 4->64|PF00313|5e-17|72.1|61/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 1->65|PF00313|3.9e-34|64.6|65/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 1->65|1c9oA|2e-21|84.6|65/66|b.40.4.5| HM:SCP:REP 1->67|2es2A1|1e-24|56.7|67/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2502 OP:NHOMOORG 773 OP:PATTERN ------------------------11131122----------------------------------11 553-721222222223322-24223322222333335585333343221223354312--443154688621-111111-21411122---------------1---121---------------11112122211-----------1-----------------------------------32122--2123666666666666676213333667211436233333365-33333333333332222235-213312-1-4322334222212561111111--------------1111111111111-11222111312222333323312-1445211-5-112-11--11241-3421111121121-33341111143B55B444444533233333232-55375445484-4443655676753312243676565442222222223333333------------1111111111111----21-42155555666566533324468444434557586512444221--------3212323231111111224233-4526-----1----666334653555561551-------------------1---1114433664349B433333332332333333411-121311122245445737557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----6665245462221222111111123422423334445555666656666555522222222224448444444444433333333332222115-----------------11-11----1--------1-------2311122222--- --------------1-------1---------------------------1----------------------------------------------------12---5--3323121-111317A1725J3-51A-1-28--42121215-15-42-1---2921-11--2211----521-123144-2422----- ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEEETTTTEEEEEETTEEEEEEEGGGccccccccccTTcEEEEEEEEETTEEEEEEEEEcc DISOP:02AL 57-62, 66-67| PSIPRED ccccEEEEEEccccEEEEEEccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEccc //