[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : cspR
DDBJ      :cspR         putative rRNA methylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  725/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.116.1
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->157 1mxiA PDBj 2e-31 44.3 %
:RPS:PDB   6->157 3e5yA PDBj 2e-33 41.1 %
:RPS:SCOP  6->159 1v2xA  c.116.1.1 * 2e-40 26.0 %
:HMM:SCOP  5->162 1mxiA_ c.116.1.1 * 8.8e-43 40.6 %
:RPS:PFM   6->148 PF00588 * SpoU_methylase 7e-10 31.9 %
:HMM:PFM   6->148 PF00588 * SpoU_methylase 1.8e-38 35.3 139/142  
:BLT:SWISS 4->159 YGL3_BACST 3e-60 67.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12721.2 GT:GENE cspR GT:PRODUCT putative rRNA methylase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 970135..970617 GB:FROM 970135 GB:TO 970617 GB:DIRECTION + GB:GENE cspR GB:PRODUCT putative rRNA methylase GB:FUNCTION 16.6: Maintain GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 12682299; Product type pe : putative enzyme GB:PROTEIN_ID CAB12721.2 GB:DB_XREF GOA:O31590 InterPro:IPR016914 SubtiList:BG11802 UniProtKB/TrEMBL:O31590 GB:GENE:GENE cspR LENGTH 160 SQ:AASEQ MNIVALHVVLYQPEIPANTGNIARTCAATNTTLHLIRPLGFSTDDKMLKRAGLDYWEFVNVVYHDSLEELFEAYKKGKFFFITKFGQQPHTSFDYTDLDEDYFFVFGRETSGLPKDLIQNNMDRCLRLPMTEHVRSLNLSNTAAILVYEALRQQNYRDLK GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 4->159|YGL3_BACST|3e-60|67.3|156/157| SEG 75->86|kkgkfffitkfg| BL:PDB:NREP 1 BL:PDB:REP 6->157|1mxiA|2e-31|44.3|149/156| RP:PDB:NREP 1 RP:PDB:REP 6->157|3e5yA|2e-33|41.1|151/156| RP:PFM:NREP 1 RP:PFM:REP 6->148|PF00588|7e-10|31.9|141/143|SpoU_methylase| HM:PFM:NREP 1 HM:PFM:REP 6->148|PF00588|1.8e-38|35.3|139/142|SpoU_methylase| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF00588|IPR001537| GO:PFM GO:0006396|"GO:RNA processing"|PF00588|IPR001537| GO:PFM GO:0008173|"GO:RNA methyltransferase activity"|PF00588|IPR001537| RP:SCP:NREP 1 RP:SCP:REP 6->159|1v2xA|2e-40|26.0|150/192|c.116.1.1| HM:SCP:REP 5->162|1mxiA_|8.8e-43|40.6|155/156|c.116.1.1|1/1|alpha/beta knot| OP:NHOMO 749 OP:NHOMOORG 740 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-111111111111111111111----11-1---111111-------11----11111111-11-------------------11-------111111111111111---------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111-111111111111111111-111-1111-11111111111111111111111111111-11111111111-111111111111111-1-1----------------------11-----------------------------1111-11111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111----11-111-11111111-1-------1111111111111111111111111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111----------1----1-111-111111111111111----------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111116111-121-2-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 98.8 SQ:SECSTR #cccccEEEEEccccHHHHHHHHHHHHHHTcEEEEEccccccccHHHHHHTTccHHHHHTcEEEccHHHHHHHHcccGGGEEEEccETTcEEGGGccccTTcEEEEEcTTTcccHHHHTccGGGEEEcccccccccccHHHHHHHHHHHHHHHTTTTTT# DISOP:02AL 160-161| PSIPRED cccccEEEEEEccccccHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHccHHHcccEEEEccHHHHHHHHHHccEEEEEccccccccccccccccccEEEEEccccccccHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHccccccc //