[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dapB
DDBJ      :dapB         dihydrodipicolinate reductase
Swiss-Prot:DAPB_BACSU   RecName: Full=Dihydrodipicolinate reductase;         Short=DHPR;         EC=1.3.1.26;

Homologs  Archaea  29/68 : Bacteria  779/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->267 1yl7B PDBj 7e-50 46.3 %
:RPS:PDB   3->260 1arzC PDBj 1e-10 28.2 %
:RPS:SCOP  1->127 1cqiA1  c.2.1.8 * 6e-11 16.8 %
:RPS:SCOP  130->238 1c3vA2  d.81.1.3 * 1e-40 56.0 %
:HMM:SCOP  2->158 1dihA1 c.2.1.3 * 2.6e-35 36.6 %
:HMM:SCOP  130->238 1p9lA2 d.81.1.3 * 2.7e-40 52.3 %
:RPS:PFM   6->129 PF01113 * DapB_N 3e-17 44.1 %
:RPS:PFM   132->266 PF05173 * DapB_C 1e-24 45.0 %
:HMM:PFM   132->265 PF05173 * DapB_C 2.6e-41 38.9 126/132  
:HMM:PFM   6->129 PF01113 * DapB_N 2.1e-33 40.0 120/124  
:BLT:SWISS 1->267 DAPB_BACSU e-152 100.0 %
:PROS 151->168|PS01298|DAPB

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14165.1 GT:GENE dapB GT:PRODUCT dihydrodipicolinate reductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2359340..2360143) GB:FROM 2359340 GB:TO 2360143 GB:DIRECTION - GB:GENE dapB GB:PRODUCT dihydrodipicolinate reductase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.13: Shape GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12682299, 6422596, 9398235; Product type e : enzyme GB:PROTEIN_ID CAB14165.1 GB:DB_XREF GOA:P42976 InterPro:IPR016040 SubtiList:BG11207 UniProtKB/Swiss-Prot:P42976 GB:GENE:GENE dapB LENGTH 267 SQ:AASEQ MSNETIKLVIAGPRGRMGQEAVKLAERTPHFDLVGAIDHTYDQQKLSDVMPVESDAFIYTDIHACFTETQPDVLIDLTTPEIGKVHTKIALEHGVRPVVGTTGFSEADLKELTSLTEEKGIGAIIAPNFALGAILMMKFSKMAANYFEDVEIIELHHDQKLDAPSGTALKTAEMISEVRKEKQQGHPDEKEILPGARGAEQNGIRLHSVRLPGLIAHQEVMFGMDGQTLQIRHDSYNRASFMSGVKLSVEQVMKIDQLVYGLENIID GT:EXON 1|1-267:0| SW:ID DAPB_BACSU SW:DE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR; EC=1.3.1.26; SW:GN Name=dapB; OrderedLocusNames=BSU22490; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Diaminopimelate biosynthesis; Lysine biosynthesis; NADP;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->267|DAPB_BACSU|e-152|100.0|267/267| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 151->168|PS01298|DAPB|PDOC01000| BL:PDB:NREP 1 BL:PDB:REP 67->267|1yl7B|7e-50|46.3|201/244| RP:PDB:NREP 1 RP:PDB:REP 3->260|1arzC|1e-10|28.2|255/271| RP:PFM:NREP 2 RP:PFM:REP 6->129|PF01113|3e-17|44.1|118/123|DapB_N| RP:PFM:REP 132->266|PF05173|1e-24|45.0|129/136|DapB_C| HM:PFM:NREP 2 HM:PFM:REP 132->265|PF05173|2.6e-41|38.9|126/132|DapB_C| HM:PFM:REP 6->129|PF01113|2.1e-33|40.0|120/124|DapB_N| GO:PFM:NREP 6 GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF01113|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01113|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01113|IPR000846| GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF05173|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF05173|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05173|IPR000846| RP:SCP:NREP 2 RP:SCP:REP 1->127|1cqiA1|6e-11|16.8|113/121|c.2.1.8| RP:SCP:REP 130->238|1c3vA2|1e-40|56.0|109/109|d.81.1.3| HM:SCP:REP 2->158|1dihA1|2.6e-35|36.6|153/163|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 130->238|1p9lA2|2.7e-40|52.3|109/109|d.81.1.3|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 854 OP:NHOMOORG 817 OP:PATTERN -----------------------11--111111111111111112111111111-------------- 11-1111111111111111-11--1111111111111111111211111111111111--1111111111111111111121111111111111---1-111111-1111111111111-111111111111-111-11--111111111111111111111111111111111111111111-----11-1111111111111111111111111111111111111111111--1-11-1111-11-111111--11-1-1-111111-11111111-------11111111111111-------------111111111111112222222212122221111112--111111111111-111111--1121111-11111111111111111111111111111-1111111112-1111122121111111-1111111111111111111-11-1-1111--------1111111111111111111111--1111111111111111111111111111112222111111111111111111111111111111111111111---1111111--11111111112-1111-1111111111111111--11111111111112111111111111111111111111111--11111111111111111-1111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111-11-1111111111111----------1-------------------------1111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------3--1-----------1124-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 100.0 SQ:SECSTR ccccccEEEETTTTcHHHHHHHHHHHHcTTcEEEEEccccccTTTTccHHTccccccccccccHHHHTTcccEEEEcccHHHHHHHHHHHHHTTcEEEEccccccHHHHHHHHHHTTTcTcEEEEcccccHHHHHHHHHHHHHHHHHTTEEEEEEEcTTccccccHHHHHHHHHHHHHTcTccHHHHEEcccccccccccTTcEEEEEEEcTTccEEEEEEEEccccEEEEEEEEccTHHHHHHHHHHHHHTTTcccEEEcHHHHHc DISOP:02AL 1-3, 195-197| PSIPRED cccccEEEEEEccccHHHHHHHHHHHHccccEEEEEEEccccccHHHcccccccccEEcccHHHHHHcccccEEEEcccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHHcccccEEEHHHHcc //