[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dat
DDBJ      :dat          D-alanine aminotransferase
Swiss-Prot:DAAA_BACSU   RecName: Full=D-alanine aminotransferase;         EC=2.6.1.21;AltName: Full=D-aspartate aminotransferase;AltName: Full=D-amino acid aminotransferase;AltName: Full=D-amino acid transaminase;         Short=DAAT;

Homologs  Archaea  37/68 : Bacteria  580/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:282 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->275 1daaA PDBj 2e-66 44.5 %
:RPS:PDB   3->273 1daaA PDBj 1e-74 43.5 %
:RPS:SCOP  3->277 1a0gA  e.17.1.1 * 1e-83 43.6 %
:HMM:SCOP  1->276 1daaA_ e.17.1.1 * 9.5e-85 39.5 %
:RPS:PFM   42->256 PF01063 * Aminotran_4 2e-24 36.7 %
:HMM:PFM   43->271 PF01063 * Aminotran_4 1.2e-40 32.6 215/232  
:BLT:SWISS 1->282 DAAA_BACSU e-158 100.0 %
:PROS 176->205|PS00770|AA_TRANSFER_CLASS_4

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12806.1 GT:GENE dat GT:PRODUCT D-alanine aminotransferase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1041994..1042842 GB:FROM 1041994 GB:TO 1042842 GB:DIRECTION + GB:GENE dat GB:PRODUCT D-alanine aminotransferase GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 17005988, 9003455; Product type e: enzyme GB:PROTEIN_ID CAB12806.1 GB:DB_XREF GOA:O07597 HSSP:1DAA InterPro:IPR005784 SubtiList:BG13045 UniProtKB/Swiss-Prot:O07597 GB:GENE:GENE dat LENGTH 282 SQ:AASEQ MKVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGISLPFSIEDLEWDLQKLVQENAVSEGAVYIQTTRGVAPRKHQYEAGLEPQTTAYTFTVKKPEQEQAYGVAAITDEDLRWLRCDIKSLNLLYNVMTKQRAYEAGAFEAILLRDGVVTEGTSSNVYAVINGTVRTHPANRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFISSTTAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQQAASIS GT:EXON 1|1-282:0| SW:ID DAAA_BACSU SW:DE RecName: Full=D-alanine aminotransferase; EC=2.6.1.21;AltName: Full=D-aspartate aminotransferase;AltName: Full=D-amino acid aminotransferase;AltName: Full=D-amino acid transaminase; Short=DAAT; SW:GN Name=dat; Synonyms=yheM; OrderedLocusNames=BSU09670; SW:KW Aminotransferase; Complete proteome; Pyridoxal phosphate; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->282|DAAA_BACSU|e-158|100.0|282/282| GO:SWS:NREP 2 GO:SWS GO:0008483|"GO:transaminase activity"|Aminotransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 176->205|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| BL:PDB:NREP 1 BL:PDB:REP 4->275|1daaA|2e-66|44.5|272/277| RP:PDB:NREP 1 RP:PDB:REP 3->273|1daaA|1e-74|43.5|271/277| RP:PFM:NREP 1 RP:PFM:REP 42->256|PF01063|2e-24|36.7|207/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 43->271|PF01063|1.2e-40|32.6|215/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 3->277|1a0gA|1e-83|43.6|275/280|e.17.1.1| HM:SCP:REP 1->276|1daaA_|9.5e-85|39.5|276/277|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1141 OP:NHOMOORG 647 OP:PATTERN ------------------111--1211223221111111111111111111111-----------122 11211---------------------------1---1-1--111--1----1-1----11-21-2112111----1----1-111111------------112112-121---------------111111111112222211122311211111221111111122----111111111121---1111-22355555555455555522224255533321221111112112222222222222222221------------------1---------------------------------------------------1212211111111111-114111-1---2--12332-1111221111-1-2111111-----223211122222122222222115-22222221353-43322322323323142454545531411111111211-1124-----------------------------11-1--1444323323342222222133332332321221111222111122431221232321-------2222331-3113212131121-------1-222212-112222111112-1-------11111112221222-111--1-1--111--1-11-11---3333------12332122222222222-2222222222222222221111331221211111111111111122222221-11111111111112-1111112222323-1---------------221121211121222211111111121111--------212222222211121--------------231-111111-------------------------------------2-1-11111111 ------1--------1----11--111---------------------111122----------------------------------------------1-------2----------------------------------------------------------------1--12-P1--114353-3211----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 99.6 SQ:SECSTR ccEEETTEEEEGGGccccTTcHHHHHccEEEEEEEEETTEEccHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHTcccEEEEEEEEcccccccccccccccccEEEEEEEccccHHHHHHcEEEEEEEccccccTTccccccHHHHHHHHHHHHTTccEEEEEETTEEEEETTcEEEEEETTEEEEccccTTccccHHHHHHHHHHHHTTccEEcccccHHHHHTccEEEEEETTTEEEEEEEETTEEcTTccccHHHHHHHHHHTTTccHHccc# DISOP:02AL 279-282| PSIPRED cEEEEccEEEcccccEEcHHHHHHHHcHHHEEEEEEEccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccEEEEEEEEEccccccccccccccEEEEEEEEEccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHccccEEEEEEccEEEEEEcEEEEEEEccEEEEccccccccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHEEEccccEEEEEEEEEccEEcccccccHHHHHHHHHHHHHHHHHcccc //