[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dhbB
DDBJ      :dhbB         isochorismatase
Swiss-Prot:DHBB_BACSU   RecName: Full=Isochorismatase;         EC=3.3.2.1;AltName: Full=2,3 dihydro-2,3 dihydroxybenzoate synthase;AltName: Full=Superoxide-inducible protein 1;         Short=SOI1;

Homologs  Archaea  28/68 : Bacteria  187/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.28.1c.33.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->299 2fq1B PDBj 1e-78 51.4 %
:RPS:PDB   30->206 3eefA PDBj 1e-31 23.5 %
:RPS:PDB   231->304 2cq8A PDBj 2e-08 23.3 %
:RPS:SCOP  2->208 1nf8A  c.33.1.3 * 2e-57 49.8 %
:RPS:SCOP  229->301 1af8A  a.28.1.1 * 1e-07 16.4 %
:HMM:SCOP  1->264 1nbaA_ c.33.1.3 * 3.5e-64 41.2 %
:HMM:SCOP  231->301 1klpA_ a.28.1.1 * 2.5e-09 32.4 %
:RPS:PFM   31->190 PF00857 * Isochorismatase 6e-18 36.3 %
:RPS:PFM   235->291 PF00550 * PP-binding 6e-05 38.6 %
:HMM:PFM   32->203 PF00857 * Isochorismatase 5.1e-40 30.4 171/174  
:HMM:PFM   235->293 PF00550 * PP-binding 3.5e-12 33.9 59/67  
:BLT:SWISS 1->312 DHBB_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15187.1 GT:GENE dhbB GT:PRODUCT isochorismatase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3287675..3288613) GB:FROM 3287675 GB:TO 3288613 GB:DIRECTION - GB:GENE dhbB GB:PRODUCT isochorismatase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 12354229, 16672620, 9214294; Product type e : enzyme GB:PROTEIN_ID CAB15187.1 GB:DB_XREF GOA:P45743 InterPro:IPR006162 SubtiList:BG11241 UniProtKB/Swiss-Prot:P45743 GB:GENE:GENE dhbB LENGTH 312 SQ:AASEQ MAIPAIQPYQMPTASDMPQNKVSWVPDPNRAVLLIHDMQNYFVDAFTAGASPVTELSANIRKLKNQCVQLGIPVVYTAQPGSQNPDDRALLTDFWGPGLNSGPYEEKIITELAPEDDDLVLTKWRYSAFKRTNLLEMMRKEGRDQLIITGIYAHIGCLVTACEAFMEDIKAFFVGDAVADFSLEKHQMALEYAAGRCAFTVMTDSLLDQLQNAPADVQKTSANTGKKNVFTCENIRKQIAELLQETPEDITDQEDLLDRGLDSVRIMTLVEQWRREGAEVTFVELAERPTIEEWQKLLTTRSQQVLPNADYL GT:EXON 1|1-312:0| SW:ID DHBB_BACSU SW:DE RecName: Full=Isochorismatase; EC=3.3.2.1;AltName: Full=2,3 dihydro-2,3 dihydroxybenzoate synthase;AltName: Full=Superoxide-inducible protein 1; Short=SOI1; SW:GN Name=dhbB; OrderedLocusNames=BSU31970; SW:KW Complete proteome; Direct protein sequencing; Hydrolase;Phosphopantetheine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->312|DHBB_BACSU|0.0|100.0|312/312| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 4->299|2fq1B|1e-78|51.4|278/279| RP:PDB:NREP 2 RP:PDB:REP 30->206|3eefA|1e-31|23.5|166/168| RP:PDB:REP 231->304|2cq8A|2e-08|23.3|73/110| RP:PFM:NREP 2 RP:PFM:REP 31->190|PF00857|6e-18|36.3|157/173|Isochorismatase| RP:PFM:REP 235->291|PF00550|6e-05|38.6|57/67|PP-binding| HM:PFM:NREP 2 HM:PFM:REP 32->203|PF00857|5.1e-40|30.4|171/174|Isochorismatase| HM:PFM:REP 235->293|PF00550|3.5e-12|33.9|59/67|PP-binding| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 2 RP:SCP:REP 2->208|1nf8A|2e-57|49.8|205/207|c.33.1.3| RP:SCP:REP 229->301|1af8A|1e-07|16.4|73/86|a.28.1.1| HM:SCP:REP 1->264|1nbaA_|3.5e-64|41.2|238/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| HM:SCP:REP 231->301|1klpA_|2.5e-09|32.4|71/115|a.28.1.1|1/1|ACP-like| OP:NHOMO 253 OP:NHOMOORG 223 OP:PATTERN --111-11111111111111111-1--11111---------------------1--------1----- --1-1------11-31111-11---111111-11111111-1-2---------------------221122-----------1----------------------1--------------------------------------12------------------------------------------11---2111111112111111--11-2111----1---------1---------------1---1--------------------------------------------------------------------------------------------------------------1---------2------------------------111111111-----1----------------------------1--------------------------------------------------------------------11--------------1-1---------------------------1------------------------------------------12-1---------------------------11---1-------------------------------------1121-1-1111111111-11211111111111111111112131-111111111111111111111111-----------------------------1-2---------------22222-1---1-2222----1---------------------1111112--1111----------------------------------------------------------1--111-1111-- -----------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------111--1-21--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 94.6 SQ:SECSTR ##cccccccccccGGGcccccccccccTTcEEEEEEccHHHHTcTcccTccHHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTHHHHHHHHHccccTTcGGGcccGGGcccTTcEEEEEccccTTTTcccHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEEccccTTHHHHHHHHHHHccEEEcTTccHHHHH##cccccccHH######ccHHHHHHHHHHHHcccccccccTTccHHHHHccTTHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHc####### DISOP:02AL 216-227, 306-312| PSIPRED cccccccccccccHHHcccccccccccccccEEEEEEccHHHccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccccHHHHHHHccccccEEEEccccccccccHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHccccEEEcccHHHHHHcccccccccccHHHcccHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEcHHHHHccccHHHHHHHHHHHccccccccccc //