[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dltE
DDBJ      :dltE         putative oxidoreductase
Swiss-Prot:DLTE_BACSU   RecName: Full=Uncharacterized oxidoreductase dltE;         EC=1.-.-.-;

Homologs  Archaea  35/68 : Bacteria  771/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:252 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->197 1ae1B PDBj 7e-20 30.1 %
:RPS:PDB   1->187 2ae1A PDBj 3e-34 29.7 %
:RPS:SCOP  7->222 1a27A  c.2.1.2 * 2e-32 24.6 %
:HMM:SCOP  1->230 1zemA1 c.2.1.2 * 1.8e-53 28.5 %
:RPS:PFM   9->166 PF00106 * adh_short 4e-14 37.3 %
:HMM:PFM   6->170 PF00106 * adh_short 3.8e-37 28.9 159/167  
:BLT:SWISS 1->252 DLTE_BACSU e-144 100.0 %
:PROS 139->167|PS00061|ADH_SHORT

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15880.2 GT:GENE dltE GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3956492..3957250 GB:FROM 3956492 GB:TO 3957250 GB:DIRECTION + GB:GENE dltE GB:PRODUCT putative oxidoreductase GB:FUNCTION 16.13: Shape 16.8: Protect GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId: 14665680, 7797557; Product type pe: putative enzyme GB:PROTEIN_ID CAB15880.2 GB:DB_XREF GOA:P39577 HSSP:2AE1 InterPro:IPR016040 SubtiList:BG10547 UniProtKB/Swiss-Prot:P39577 GB:GENE:GENE dltE LENGTH 252 SQ:AASEQ MKMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAEAKQQLPNIHTKQCDVADRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEELFVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHQLRDTSVEVIEMAPPMVDTGLNQKSRDKQGLTYRGISSEEYVQYFLDGLKEGKQEITNERVEGLRDATRADYDRLFEQMNTQEN GT:EXON 1|1-252:0| SW:ID DLTE_BACSU SW:DE RecName: Full=Uncharacterized oxidoreductase dltE; EC=1.-.-.-; SW:GN Name=dltE; OrderedLocusNames=BSU38540; ORFNames=ipa-1r; SW:KW Complete proteome; Cytoplasm; NAD; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->252|DLTE_BACSU|e-144|100.0|252/252| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 139->167|PS00061|ADH_SHORT|PDOC00060| BL:PDB:NREP 1 BL:PDB:REP 3->197|1ae1B|7e-20|30.1|193/258| RP:PDB:NREP 1 RP:PDB:REP 1->187|2ae1A|3e-34|29.7|185/252| RP:PFM:NREP 1 RP:PFM:REP 9->166|PF00106|4e-14|37.3|150/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 6->170|PF00106|3.8e-37|28.9|159/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 7->222|1a27A|2e-32|24.6|211/285|c.2.1.2| HM:SCP:REP 1->230|1zemA1|1.8e-53|28.5|228/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 4684 OP:NHOMOORG 998 OP:PATTERN ----1-211121113-1---111-522522-3--------------23--412-11--1--1222-13 AAC-C-1---1321GFA54-5922CF55555DAGHG7GHG17455334162-733224--3242134DE33----11121-21111--2221-2-1---44G182pBE461111111---1111422346431352111111117-B89A5541211-2-1111213ECJ52-2-111-3-114221133144A66566775457788748AA4C76633497616554745G433333323333333544266-114411---461144133125444222333322222222222222342234333443232222222233243D33322222234366234441-11-52--231---122-11-2121326733411-1194EC9-112233233333332337-333349587B-2DDD6ICBINJED3453253232125333333333327832252---1111111----11--11-1---1-1-33534433323GCDECE5455499A6666634A9E8BA824667315558677E3284-3482--------1-363169232-121-111-225114-111141288-1-1111111111-1-------2-2-1223443755364513344343332463244-7--11121------228E1652341222332-4223222332422222223BED663242111131211111111D22222221-232333333332---145434455517676111313-11111--2DEDDE6A47631886664C587797776611111111122445333335452355956552221-----12886655--------1-2----2---2-1------2-------22221-3-1-241 1-11IE7-42211293BA6BAABEJDA462434573354434475477CI9AED4583552435434324535563313435673636-766B58312225-3963-542gBHAAC74655592961D3FjA-9693231B33A526543912A6AA99QVG7IJA7JEMO7EBD2551C-1139477E5R64495B82 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 99.6 SQ:SECSTR TccTTcEEEEETcccHHHHHHHHHHHTTTcEEEEEEccHHHHHHHHHHHccEEEEEccTTcHHHHHHHHHHHHHHTTTccEEEEcccccccccGGGccHHHHHHHHHHHHHTHHHHHHHHHHHHHHHTTccEEEEEEccGGGTcccTTcHHHHHHHHHHHHHHHHHHHHTGGGTEEEEEEEEccccccTTTTccccHHcHHHHHccHHHHHHHHHHHHHHHHEEEEcccTTccccGGGcccTTccHHHHcc# PSIPRED ccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccEEcHHHHHHHHHHHHccHHHHHHHHHcccc //