[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dnaA
DDBJ      :dnaA         chromosomal replication initiator protein DnaA
Swiss-Prot:DNAA_BACSU   RecName: Full=Chromosomal replication initiator protein dnaA;

Homologs  Archaea  0/68 : Bacteria  903/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.12c.37.1
:446 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->73 2e0gA PDBj 2e-08 33.8 %
:BLT:PDB   111->346 2z4rA PDBj 1e-68 50.6 %
:BLT:PDB   354->443 1j1vA PDBj 1e-18 54.3 %
:RPS:PDB   5->87 2e0gA PDBj 1e-18 28.0 %
:RPS:PDB   83->325 3bq9A PDBj 5e-35 10.4 %
:RPS:SCOP  109->319 1l8qA2  c.37.1.20 * 1e-43 43.5 %
:RPS:SCOP  354->446 1j1vA  a.4.12.2 * 1e-30 43.0 %
:HMM:SCOP  109->325 1l8qA2 c.37.1.20 * 4.9e-50 27.7 %
:HMM:SCOP  341->447 1l8qA1 a.4.12.2 * 1.2e-35 49.5 %
:RPS:PFM   113->327 PF00308 * Bac_DnaA 1e-93 71.2 %
:RPS:PFM   355->424 PF08299 * Bac_DnaA_C 7e-21 58.6 %
:HMM:PFM   111->327 PF00308 * Bac_DnaA 7.2e-106 63.6 217/219  
:HMM:PFM   355->424 PF08299 * Bac_DnaA_C 4.7e-35 60.0 70/70  
:HMM:PFM   4->84 PF11490 * DNA_pol3_alph_N 2.5e-07 21.8 78/180  
:BLT:SWISS 1->446 DNAA_BACSU 0.0 100.0 %
:PROS 405->424|PS01008|DNAA
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11777.1 GT:GENE dnaA GT:PRODUCT chromosomal replication initiator protein DnaA GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 410..1750 GB:FROM 410 GB:TO 1750 GB:DIRECTION + GB:GENE dnaA GB:PRODUCT chromosomal replication initiator protein DnaA GB:FUNCTION 16.9: Replicate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12682299, 16120674, 1779750, 2167836, 2846289; Product type f: factor GB:PROTEIN_ID CAB11777.1 GB:DB_XREF GOA:P05648 HSSP:1J1V InterPro:IPR013317 SubtiList:BG10065 UniProtKB/Swiss-Prot:P05648 GB:GENE:GENE dnaA LENGTH 446 SQ:AASEQ MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK GT:EXON 1|1-446:0| SW:ID DNAA_BACSU SW:DE RecName: Full=Chromosomal replication initiator protein dnaA; SW:GN Name=dnaA; Synonyms=dnaH; OrderedLocusNames=BSU00010; SW:KW ATP-binding; Complete proteome; Cytoplasm; DNA replication;DNA-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->446|DNAA_BACSU|0.0|100.0|446/446| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 405->424|PS01008|DNAA|PDOC00771| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 419->446| BL:PDB:NREP 3 BL:PDB:REP 5->73|2e0gA|2e-08|33.8|68/107| BL:PDB:REP 111->346|2z4rA|1e-68|50.6|235/240| BL:PDB:REP 354->443|1j1vA|1e-18|54.3|81/92| RP:PDB:NREP 2 RP:PDB:REP 5->87|2e0gA|1e-18|28.0|82/107| RP:PDB:REP 83->325|3bq9A|5e-35|10.4|231/446| RP:PFM:NREP 2 RP:PFM:REP 113->327|PF00308|1e-93|71.2|215/218|Bac_DnaA| RP:PFM:REP 355->424|PF08299|7e-21|58.6|70/70|Bac_DnaA_C| HM:PFM:NREP 3 HM:PFM:REP 111->327|PF00308|7.2e-106|63.6|217/219|Bac_DnaA| HM:PFM:REP 355->424|PF08299|4.7e-35|60.0|70/70|Bac_DnaA_C| HM:PFM:REP 4->84|PF11490|2.5e-07|21.8|78/180|DNA_pol3_alph_N| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF08299|IPR013159| GO:PFM GO:0006270|"GO:DNA-dependent DNA replication initiation"|PF08299|IPR013159| GO:PFM GO:0006275|"GO:regulation of DNA replication"|PF08299|IPR013159| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF08299|IPR013159| RP:SCP:NREP 2 RP:SCP:REP 109->319|1l8qA2|1e-43|43.5|207/213|c.37.1.20| RP:SCP:REP 354->446|1j1vA|1e-30|43.0|93/94|a.4.12.2| HM:SCP:REP 109->325|1l8qA2|4.9e-50|27.7|213/213|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 341->447|1l8qA1|1.2e-35|49.5|107/0|a.4.12.2|1/1|TrpR-like| OP:NHOMO 1116 OP:NHOMOORG 905 OP:PATTERN -------------------------------------------------------------------- 1111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111122222222222222222111111111111111111111111111111111111111111111111111111111111111112111222221221222112111111221121311111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111-1212111111111111111111111111111111111-1111111111111111111111111211111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111121211111111111111111221111121111111111211111111222222222222212221211111111111111111111111111111111111121112222222222222211122122222--1221111111122221222221222222-2212222222222222222222222222222222222222222222222221-222222222222--2222222222231221222222222222222111111122122111122221222212221111111111111111111111111111111111111111111111111111111111111111-111111111111111-1111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 439 STR:RPRED 98.4 SQ:SECSTR ####ccHHHHHHHHHHHHccccHHHHTTTTcEEEEEcccEEEEEEccHHHHHHHHHTHHHHHHHHHHHHTcccccEEccEEcTTTccccTTccEEEEcccHHHHHHHHHHHccEEEEccccHHHHHHHHHHHHHHHHTcGGGTTccccEEEEEcGGGHHHHHHHHHHHHHTcTTGGGGcEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccccccccGGGTccccccHHHHHTccccTTccHHHEEEHHHHHHHHHHHHHHHHHcHHHHHHHHHHccEEEEccHHTHHHHHHHHHHHHHHTTccccTTccccccEEHHHHccTTcHHHcHHHHHHHHHHHHHHHHHHHTcccccHHTccHHHHHHHHHHcccEEccTTccccHHHHTTccccccccccHHHHHHHHHHHTHHHHHHHHHcHHHHHHHHHHHHHH### DISOP:02AL 1-2, 84-112, 347-352, 427-431| PSIPRED cccHHHHHHHHHHHHHHHccHHHHHHHHHcccEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHccccccccEEEHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcc //