[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dnaN
DDBJ      :dnaN         DNA polymerase III (beta subunit)
Swiss-Prot:DPO3B_BACSU  RecName: Full=DNA polymerase III subunit beta;         EC=2.7.7.7;

Homologs  Archaea  0/68 : Bacteria  895/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.131.1
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->377 2awaB PDBj 2e-67 38.0 %
:RPS:PDB   1->377 2awaB PDBj 2e-87 39.1 %
:RPS:SCOP  1->127 1jqjA1  d.131.1.1 * 8e-32 28.3 %
:RPS:SCOP  130->251 1vpkA2  d.131.1.1 * 4e-33 25.0 %
:RPS:SCOP  254->376 1vpkA3  d.131.1.1 * 1e-22 27.5 %
:HMM:SCOP  1->128 1vpkA1 d.131.1.1 * 2.5e-24 31.7 %
:HMM:SCOP  130->252 2polA2 d.131.1.1 * 3.2e-26 30.3 %
:HMM:SCOP  253->377 2polA3 d.131.1.1 * 6.9e-31 39.3 %
:RPS:PFM   1->127 PF00712 * DNA_pol3_beta 1e-16 45.4 %
:RPS:PFM   137->251 PF02767 * DNA_pol3_beta_2 6e-24 47.8 %
:RPS:PFM   255->376 PF02768 * DNA_pol3_beta_3 2e-17 42.9 %
:HMM:PFM   1->127 PF00712 * DNA_pol3_beta 5.4e-44 45.4 119/120  
:HMM:PFM   136->251 PF02767 * DNA_pol3_beta_2 4.2e-43 47.4 116/116  
:HMM:PFM   254->376 PF02768 * DNA_pol3_beta_3 2e-41 36.7 120/121  
:BLT:SWISS 1->378 DPO3B_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11778.1 GT:GENE dnaN GT:PRODUCT DNA polymerase III (beta subunit) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1939..3075 GB:FROM 1939 GB:TO 3075 GB:DIRECTION + GB:GENE dnaN GB:PRODUCT DNA polymerase III (beta subunit) GB:FUNCTION 16.9: Replicate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11395445, 12682299, 2846289; Product type e: enzyme GB:PROTEIN_ID CAB11778.1 GB:DB_XREF GOA:P05649 InterPro:IPR001001 SubtiList:BG10066 UniProtKB/Swiss-Prot:P05649 GB:GENE:GENE dnaN LENGTH 378 SQ:AASEQ MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY GT:EXON 1|1-378:0| SW:ID DPO3B_BACSU SW:DE RecName: Full=DNA polymerase III subunit beta; EC=2.7.7.7; SW:GN Name=dnaN; Synonyms=dnaG; OrderedLocusNames=BSU00020; SW:KW Complete proteome; Cytoplasm; DNA replication;DNA-directed DNA polymerase; Nucleotidyltransferase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->378|DPO3B_BACSU|0.0|100.0|378/378| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003887|"GO:DNA-directed DNA polymerase activity"|DNA-directed DNA polymerase| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 298->309|esieissnspei| BL:PDB:NREP 1 BL:PDB:REP 3->377|2awaB|2e-67|38.0|371/375| RP:PDB:NREP 1 RP:PDB:REP 1->377|2awaB|2e-87|39.1|373/375| RP:PFM:NREP 3 RP:PFM:REP 1->127|PF00712|1e-16|45.4|119/119|DNA_pol3_beta| RP:PFM:REP 137->251|PF02767|6e-24|47.8|115/116|DNA_pol3_beta_2| RP:PFM:REP 255->376|PF02768|2e-17|42.9|119/121|DNA_pol3_beta_3| HM:PFM:NREP 3 HM:PFM:REP 1->127|PF00712|5.4e-44|45.4|119/120|DNA_pol3_beta| HM:PFM:REP 136->251|PF02767|4.2e-43|47.4|116/116|DNA_pol3_beta_2| HM:PFM:REP 254->376|PF02768|2e-41|36.7|120/121|DNA_pol3_beta_3| GO:PFM:NREP 15 GO:PFM GO:0003677|"GO:DNA binding"|PF00712|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF00712|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF00712|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF00712|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF00712|IPR001001| GO:PFM GO:0003677|"GO:DNA binding"|PF02767|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF02767|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF02767|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF02767|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF02767|IPR001001| GO:PFM GO:0003677|"GO:DNA binding"|PF02768|IPR001001| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF02768|IPR001001| GO:PFM GO:0006260|"GO:DNA replication"|PF02768|IPR001001| GO:PFM GO:0008408|"GO:3'-5' exonuclease activity"|PF02768|IPR001001| GO:PFM GO:0009360|"GO:DNA polymerase III complex"|PF02768|IPR001001| RP:SCP:NREP 3 RP:SCP:REP 1->127|1jqjA1|8e-32|28.3|120/122|d.131.1.1| RP:SCP:REP 130->251|1vpkA2|4e-33|25.0|120/123|d.131.1.1| RP:SCP:REP 254->376|1vpkA3|1e-22|27.5|120/123|d.131.1.1| HM:SCP:REP 1->128|1vpkA1|2.5e-24|31.7|120/0|d.131.1.1|1/3|DNA clamp| HM:SCP:REP 130->252|2polA2|3.2e-26|30.3|122/0|d.131.1.1|2/3|DNA clamp| HM:SCP:REP 253->377|2polA3|6.9e-31|39.3|122/0|d.131.1.1|1/1|DNA clamp| OP:NHOMO 949 OP:NHOMOORG 896 OP:PATTERN -------------------------------------------------------------------- 1111111111111111112-11111111111111112111112221111111111111111111211221211111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111122111111111111111111111141122222232123323311111122211121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112312111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111211111111111111131111111111111111111111111112111111111111111111111111112111111111111111111111111111111111111111111111111121111111111112111111111111211-1-11--111-111111111111111111111-11111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111-11111--1111-11111111-----1111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 377 STR:RPRED 99.7 SQ:SECSTR cEEEEEHHHHHHHHHHHHTTcccccccGGGGEEEEEEcccEEEEEEEcccEEEEEEEETTccGGGTcEEEEcEEEEEEHHHHHHHHHHccccEEEEEEETTTEEEEEETTEEEEEEcccGGGccccccccccccEEEEHHHHHHHHHHHGGGccccTTcGGGGEEEEEETTTEEEEEEEcccEEEEEEEEccccccccEEEEEEHHHHHHHHHHccTTccEEEEEEcccEEEEEcccEEEEEEcccccccccGGGccccccEEEEEEHHHHHHHHHHHHHHTTccccccEEEEEETETEEEEEEEETTTEEEEEEEcccEEEEccEEEEEcHHHHHHHHHTccccEEEEEEccccccEEEEEcccccEEEEEccccc# DISOP:02AL 308-309| PSIPRED cEEEEEHHHHHHHHHHHHHHccccccccEEEEEEEEEEccEEEEEEEccEEEEEEEEEcccccccEEEEEEccEEEEEHHHHHHHHHHccccEEEEEEEccEEEEEEEccEEEEEccccHHHcccccccccccEEEEcHHHHHHHHHHHEEEcccccccHHHEEEEEEEEccEEEEEEEccEEEEEEEEEcccccccccEEEEEccHHHHHHHHHcccccEEEEEEEccEEEEEEccEEEEEEEEccccccccEEccccccEEEEEEHHHHHHHHHHHHEEEccccccEEEEEEccccEEEEEEccccccEEEEEEEEEEEccccEEEEEccHHHHHHHHHccccEEEEEEEccccEEEEEEccccccEEEEEEcccc //