[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dppD
DDBJ      :dppD         dipeptide ABC transporter (ATP-binding protein)
Swiss-Prot:DPPD_BACSU   RecName: Full=Dipeptide transport ATP-binding protein dppD;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:335 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   19->274 2it1B PDBj 9e-34 34.2 %
:RPS:PDB   4->252 3b5jA PDBj 4e-49 25.8 %
:RPS:PDB   229->291 1dxrH PDBj 6e-07 1.9 %
:RPS:SCOP  5->261 1b0uA  c.37.1.12 * 7e-57 30.2 %
:HMM:SCOP  33->320 1a7jA_ c.37.1.6 * 9.9e-72 42.9 %
:RPS:PFM   54->184 PF00005 * ABC_tran 2e-18 49.6 %
:RPS:PFM   236->293 PF08352 * oligo_HPY 1e-12 50.0 %
:HMM:PFM   54->184 PF00005 * ABC_tran 6.1e-23 34.8 112/118  
:HMM:PFM   236->299 PF08352 * oligo_HPY 5.6e-21 49.2 63/64  
:HMM:PFM   29->55 PF00006 * ATP-synt_ab 3.7e-05 48.1 27/215  
:HMM:PFM   194->238 PF09818 * ABC_ATPase 0.00067 26.7 45/448  
:BLT:SWISS 1->335 DPPD_BACSU 0.0 100.0 %
:PROS 156->170|PS00211|ABC_TRANSPORTER_1
:PROS 103->111|PS00221|MIP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13152.1 GT:GENE dppD GT:PRODUCT dipeptide ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1363141..1364148 GB:FROM 1363141 GB:TO 1364148 GB:DIRECTION + GB:GENE dppD GB:PRODUCT dipeptide ABC transporter (ATP-binding protein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 7536291; Product type t : transporter GB:PROTEIN_ID CAB13152.1 GB:DB_XREF GOA:P26905 InterPro:IPR013563 SubtiList:BG10845 UniProtKB/Swiss-Prot:P26905 GB:GENE:GENE dppD LENGTH 335 SQ:AASEQ MEKVLSVQNLHVSFTTYGGTVQAVRGVSFDLYKGETFAIVGESGCGKSVTSQSIMGLLPPYSAKVTDGRILFKNKDLCRLSDKEMRGIRGADISMIFQDPMTALNPTLTVGDQLGEALLRHKKMSKKAARKEVLSMLSLVGIPDPGERLKQYPHQFSGGMRQRIVIAMALICEPDILIADEPTTALDVTIQAQILELFKEIQRKTDVSVILITHDLGVVAQVADRVAVMYAGKMAEIGTRKDIFYQPQHPYTKGLLGSVPRLDLNGAELTPIDGTPPDLFSPPPGCPFAARCPNRMVVCDRVYPGQTIRSDSHTVNCWLQDQRAEHAVLSGDAKD GT:EXON 1|1-335:0| SW:ID DPPD_BACSU SW:DE RecName: Full=Dipeptide transport ATP-binding protein dppD; SW:GN Name=dppD; Synonyms=dciAD; OrderedLocusNames=BSU12950; SW:KW ATP-binding; Cell membrane; Complete proteome; Membrane;Nucleotide-binding; Peptide transport; Protein transport; Sporulation;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->335|DPPD_BACSU|0.0|100.0|335/335| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0015833|"GO:peptide transport"|Peptide transport| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 156->170|PS00211|ABC_TRANSPORTER_1|PDOC00185| PROS 103->111|PS00221|MIP|PDOC00193| BL:PDB:NREP 1 BL:PDB:REP 19->274|2it1B|9e-34|34.2|234/361| RP:PDB:NREP 2 RP:PDB:REP 4->252|3b5jA|4e-49|25.8|233/243| RP:PDB:REP 229->291|1dxrH|6e-07|1.9|54/257| RP:PFM:NREP 2 RP:PFM:REP 54->184|PF00005|2e-18|49.6|113/123|ABC_tran| RP:PFM:REP 236->293|PF08352|1e-12|50.0|58/64|oligo_HPY| HM:PFM:NREP 4 HM:PFM:REP 54->184|PF00005|6.1e-23|34.8|112/118|ABC_tran| HM:PFM:REP 236->299|PF08352|5.6e-21|49.2|63/64|oligo_HPY| HM:PFM:REP 29->55|PF00006|3.7e-05|48.1|27/215|ATP-synt_ab| HM:PFM:REP 194->238|PF09818|0.00067|26.7|45/448|ABC_ATPase| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| GO:PFM GO:0000166|"GO:nucleotide binding"|PF08352|IPR013563| GO:PFM GO:0005524|"GO:ATP binding"|PF08352|IPR013563| GO:PFM GO:0015833|"GO:peptide transport"|PF08352|IPR013563| RP:SCP:NREP 1 RP:SCP:REP 5->261|1b0uA|7e-57|30.2|245/258|c.37.1.12| HM:SCP:REP 33->320|1a7jA_|9.9e-72|42.9|259/0|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 45557 OP:NHOMOORG 1172 OP:PATTERN OPJAOKJHVVVUWQYMjHNQKONUoNPgiQdSHEEDECHGHFDUYSUkLQ**j8TaSTSNSJJFW19A TbhJ*dYaeeiUXOVPRKJ-Jf99U*KKKKKKmhgik***OyX*o*sZqldPyvrNQgCDuspb*lz***dZaaatbYWOzchACDACPORI5LEHF--EERLJKVKRKP9AAAAAACDCCCCCISOJQRNKOPaRhooz*LKK*VqklrgekcfOSJFJDPGccRd***ZFJDJGHELDJEFbTaPLskAVas*******************zx***fox**jovqroqs**WjjjikheijjjjiiZcZaa*bXXwxYOZXctsNO**XXPTjiihiqpruqmwsqqotpojlrunqpdddcbddeffebctllihdmknki*y*********f*fi***Viig*qgoi*alSM**tjXXemQWlfsgOebTLYUSSHILJJKbU***TSn****************-on*ic*g***SB**************FJG**********ONOOOOOOtVZGOdV*66555444646667AB56764766985A6JDDGCD***********x*y*u********i********9Lyznydykq******alhQUJRhQHHIGHHHQOPVhhZ**MdXumTlsZXmJaZYSTXiWZRTUUlwW*NKHNCJJJKIH9C99ABB99GQFFKLLkotNtTZLRNyMRTUSMTbQOOPQSXTSYY6-CHTML311333*z**Y*xx**zy*z*vw-*xxxzwzyyz**zuvwuut*****eghmmikmnmmmmkkmkkk*pkmoootS4************23HHBDAADNOONNI*n*ZZYXaZHORONTNSfLNQQNGRGNVjZspspt***t**tvf***EEDCCEECEJfon*qrsrru*y**NRPLLLLJKJECDC68JTTTHIMM9B898898*AWDDFC9-GDHDHIDGGGCIJDIGAAAVfwVTo*nqkFYK -111SN8-XJ5BHQLGAE89FHCJDGFDD9CABHEC7ACA9A9768B8FKIEOGBDGACA9A73755935436715714434424536-EI8AB89778A96AHEA1FLSWNRGbTYFE78BNHkg7j9**Z3XKgKFG8W7GXLAHCB8SC9*DPKKkFd*CdGE7yLS*QWNFCEB8*BB9BAdRU*BfUBEmSdYA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 262-272, 326-335| PSIPRED ccccEEEEccEEEEEccccEEEEEEcccEEEccccEEEEEEEccccHHHHHHHHHHHccccccEEEccEEEEccEEHHcccHHHHHHHHHHHccEEEccHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHccEEEEEccHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEccccEEEEEEcccccccccccHHccc //