[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : dsdA
DDBJ      :dsdA         D-serine ammonia-lyase
Swiss-Prot:SDHD_BACSU   RecName: Full=Probable D-serine dehydratase;         EC=4.3.1.18;AltName: Full=D-serine deaminase;         Short=DSD;

Homologs  Archaea  0/68 : Bacteria  156/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.79.1
:448 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   51->435 2d1fA PDBj 6e-24 14.4 %
:RPS:SCOP  75->434 1p5jA  c.79.1.1 * 5e-28 17.2 %
:HMM:SCOP  49->441 1tdjA1 c.79.1.1 * 5.2e-55 27.8 %
:HMM:PFM   77->395 PF00291 * PALP 5.2e-34 27.2 261/297  
:BLT:SWISS 1->448 SDHD_BACSU 0.0 100.0 %
:PROS 107->121|PS00165|DEHYDRATASE_SER_THR
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14309.2 GT:GENE dsdA GT:PRODUCT D-serine ammonia-lyase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2469580..2470926) GB:FROM 2469580 GB:TO 2470926 GB:DIRECTION - GB:GENE dsdA GB:PRODUCT D-serine ammonia-lyase GB:FUNCTION 16.8: Protect 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 7592420; Product type e: enzyme GB:PROTEIN_ID CAB14309.2 GB:DB_XREF GOA:P54555 InterPro:IPR000634 SubtiList:BG11747 UniProtKB/Swiss-Prot:P54555 GB:GENE:GENE dsdA LENGTH 448 SQ:AASEQ MSVHSEVLHALLKDPFIQKLIDAEPVFWANSGKKEGPLPRADEWATEIAEAEKRMQRFAPYIAEVFPETKGAKGIIESPLFEVQHMKGKLEAAYQQPFPGRWLLKCDHELPISGSIKARGGIYEVLKYAENLALQEGMLQETDDYRILQEERFTGFFSRYSIAVGSTGNLGLSIGIIGAALGFRVTVHMSADAKQWKKDLLRQKGVTVMEYETDYSEAVNEGRRQAEQDPFCYFIDDEHSRQLFLGYAVAASRLKTQLDCMNIKPSLETPLFVYLPCGVGGGPGGVAFGLKLLYGDDVHVFFAEPTHSPCMLLGLYSGLHEKISVQDIGLDNQTAADGLAVGRPSGFVGKLIEPLLSGCYTVEDNTLYTLLHMLAVSEDKYLEPSALAGMFGPVQLFSTEEGRRYAQKYKMEHAVHVVWGTGGSMVPKDEMAAYNRIGADLLKKRNEK GT:EXON 1|1-448:0| SW:ID SDHD_BACSU SW:DE RecName: Full=Probable D-serine dehydratase; EC=4.3.1.18;AltName: Full=D-serine deaminase; Short=DSD; SW:GN Name=dsdA; Synonyms=yqjR; OrderedLocusNames=BSU23770; SW:KW Complete proteome; Lyase; Pyridoxal phosphate. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->448|SDHD_BACSU|0.0|100.0|448/448| GO:SWS:NREP 1 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 107->121|PS00165|DEHYDRATASE_SER_THR|PDOC00149| SEG 165->182|gstgnlglsigiigaalg| SEG 278->286|gvgggpggv| RP:PDB:NREP 1 RP:PDB:REP 51->435|2d1fA|6e-24|14.4|326/349| HM:PFM:NREP 1 HM:PFM:REP 77->395|PF00291|5.2e-34|27.2|261/297|PALP| RP:SCP:NREP 1 RP:SCP:REP 75->434|1p5jA|5e-28|17.2|308/319|c.79.1.1| HM:SCP:REP 49->441|1tdjA1|5.2e-55|27.8|331/331|c.79.1.1|1/1|Tryptophan synthase beta subunit-like PLP-dependent enzymes| OP:NHOMO 161 OP:NHOMOORG 157 OP:PATTERN -------------------------------------------------------------------- -------------1-----------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------111111111111111211---1111-111---------1--------------------1-------1---11------1--1-------------------------------------------------1------------------------------11-1----1-----11---------------------------------------------1---------1---11--------------------------------------------------------------------------------111----1111-111--1---------111-1-----------1-------------------1---1-------------------------------------------------11----1-----------1------1-----------------1-11-1-1111122111-11111-1121111111111111--111111111111111111111111111--1--------------------------1-1------------11-1-111-1-----1111----1-11------------------111111111--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 426 STR:RPRED 95.1 SQ:SECSTR ##############TcccccccccEEEEEcHHHHTccGHHHHTTTcccTTcccHHHHTGGGccccccccccccccccccEEEcHHHHHHHcccHHHHHccEEEEEEGGGcTTTccTTHHHHHHHHHHHHHHTTccEEEEccccH#EEEHHHHHHHHHHHHTcEEHHHHHHTTHHHHHHHHTTccEEEEccccccHHHHHHHHHTTcEEEEccccHHHHHHHHHHHHHHcTTEEEccTTcHHHHHHHHTHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHTTHHHccccccEEEEEEEGGGcHHHHcccccccccccGccccccccccGGcccccTTHHHHHHHHHHHTcEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHHHHHTccTTcEEEEEEcccGGGGGcHHHHHcHHTTcc####### PSIPRED cccHHHHHHHHHHcHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHcccHHHHHHHHcccccccccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccccccccccccccHHHHHccccHHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHccccHHHHHHccccccEEEEEEccccccHHHHHHHHHHcHHHHHHHHHcc //