[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ebrB
DDBJ      :ebrB         small multidrug efflux transporter
Swiss-Prot:EBRB_BACSU   RecName: Full=Multidrug resistance protein ebrB;

Homologs  Archaea  3/68 : Bacteria  293/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:117 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->102 1s7bB PDBj 5e-18 37.8 %
:RPS:SCOP  5->109 1s7bA  f.39.1.1 * 2e-09 35.2 %
:HMM:SCOP  5->110 1s7bA_ f.39.1.1 * 4.5e-18 31.1 %
:RPS:PFM   2->94 PF00893 * Multi_Drug_Res 4e-11 44.1 %
:HMM:PFM   4->94 PF00893 * Multi_Drug_Res 1.4e-33 52.7 91/93  
:BLT:SWISS 1->117 EBRB_BACSU 1e-53 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13613.1 GT:GENE ebrB GT:PRODUCT small multidrug efflux transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1864691..1865044) GB:FROM 1864691 GB:TO 1865044 GB:DIRECTION - GB:GENE ebrB GB:PRODUCT small multidrug efflux transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10735876, 15849754, 16750162, 16850406; Product type t: transporter GB:PROTEIN_ID CAB13613.1 GB:DB_XREF GOA:O31791 InterPro:IPR000390 SubtiList:BG12586 UniProtKB/Swiss-Prot:O31791 GB:GENE:GENE ebrB LENGTH 117 SQ:AASEQ MRGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGFLSAFTFLSFSLKTIDLSSAYATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAHAEDKKQTACE GT:EXON 1|1-117:0| SW:ID EBRB_BACSU SW:DE RecName: Full=Multidrug resistance protein ebrB; SW:GN Name=ebrB; OrderedLocusNames=BSU17290; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->117|EBRB_BACSU|1e-53|100.0|117/117| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 3 TM:REGION 1->23| TM:REGION 29->51| TM:REGION 75->97| SEG 40->51|flsaftflsfsl| BL:PDB:NREP 1 BL:PDB:REP 5->102|1s7bB|5e-18|37.8|98/107| RP:PFM:NREP 1 RP:PFM:REP 2->94|PF00893|4e-11|44.1|93/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 4->94|PF00893|1.4e-33|52.7|91/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| RP:SCP:NREP 1 RP:SCP:REP 5->109|1s7bA|2e-09|35.2|105/106|f.39.1.1| HM:SCP:REP 5->110|1s7bA_|4.5e-18|31.1|106/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 404 OP:NHOMOORG 299 OP:PATTERN -------------------------------------------------11-1--------------- ----1---------1--11-1-----11111-----------1--------------1-----------1------------2-----------------1-----------------------111--1-1111-1--11----------------111------1111---------------------1-3222221211222112--2223211-1-2--2------1---------------------1----------11------1------------------------------------------------------------------------------1------11-------------2-------------1----13121111111111112-1------1----------11112112-1----1111-1-11111111----1-21-----------------------------1--1--1111211111111111111-11111111----------112-11---1-----3--11--11--------211---------11-------1-------1-1--------------------------1111--1---1-1------1-------1--1----2---------1-112112222233322-31231121233222222221--212221---1211211111-3211122221122222222222211-2-1-------11--2111----------1---1-4--11--11121-12-----11-11-----1--------111111----2212121111----------11--------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 98 STR:RPRED 83.8 SQ:SECSTR ####HHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHHHH############### DISOP:02AL 103-117| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcc //