[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : exoA
DDBJ      :exoA         5'3'-exonuclease
Swiss-Prot:EX53_BACSU   RecName: Full=5'-3' exonuclease;         EC=3.1.11.-;

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  29/199 : Viruses  1/175   --->[See Alignment]
a.60.7c.120.1
:296 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->255 1cmwA PDBj 4e-37 37.8 %
:RPS:PDB   3->294 1b43A PDBj 6e-50 15.3 %
:RPS:SCOP  3->172 1a76A2  c.120.1.2 * 7e-32 17.2 %
:RPS:SCOP  177->271 1exnA1  a.60.7.1 * 9e-20 24.2 %
:HMM:SCOP  3->174 1bgxT2 c.120.1.2 * 8.5e-46 45.7 %
:HMM:SCOP  175->291 1bgxT1 a.60.7.1 * 8.7e-29 41.4 %
:RPS:PFM   4->178 PF02739 * 5_3_exonuc_N 6e-34 46.6 %
:RPS:PFM   175->261 PF01367 * 5_3_exonuc 8e-18 48.3 %
:HMM:PFM   4->172 PF02739 * 5_3_exonuc_N 1.3e-59 46.7 167/169  
:HMM:PFM   175->264 PF01367 * 5_3_exonuc 8.9e-32 47.8 90/101  
:BLT:SWISS 1->296 EX53_BACSU e-170 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14118.1 GT:GENE exoA GT:PRODUCT 5'3'-exonuclease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2310995..2311885) GB:FROM 2310995 GB:TO 2311885 GB:DIRECTION - GB:GENE exoA GB:PRODUCT 5'3'-exonuclease GB:FUNCTION 16.6: Maintain 16.9: Replicate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 16045613, 17038322, 17905985; Product type e: enzyme GB:PROTEIN_ID CAB14118.1 GB:DB_XREF GOA:P54161 HSSP:1BGX InterPro:IPR008918 SubtiList:BG11606 UniProtKB/Swiss-Prot:P54161 GB:GENE:GENE exoA LENGTH 296 SQ:AASEQ MNNNKLLLVDGMALLFRAFFATAVHRNFMINDSGVPTNGVNGFLKHLITAVETFQPTHVVCCWDMGSKTYRNDLFQDYKANRSAPPVELIPQFDLAKEAAAELGIMNIGFAGYEADDCIGTLADLFANEADITVVTGDRDLLQLLTDKVSVALLQKGIGNYKVYTKETFYEETGVMPKALIDIKALMGDSSDNYPGVKGIGEKTAYKLIREYETIDRLLENLSLLPKGQQGKIQQGLSDLEMSRKLAEIHCSVPLACTLKDALFTLQMEQAADMLRRHQIKGIERMLEKLNAREIV GT:EXON 1|1-296:0| SW:ID EX53_BACSU SW:DE RecName: Full=5'-3' exonuclease; EC=3.1.11.-; SW:GN Name=ypcP; OrderedLocusNames=BSU22010; SW:KW Complete proteome; DNA-binding; Exonuclease; Hydrolase; Nuclease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->296|EX53_BACSU|e-170|100.0|296/296| GO:SWS:NREP 4 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| BL:PDB:NREP 1 BL:PDB:REP 5->255|1cmwA|4e-37|37.8|241/817| RP:PDB:NREP 1 RP:PDB:REP 3->294|1b43A|6e-50|15.3|275/339| RP:PFM:NREP 2 RP:PFM:REP 4->178|PF02739|6e-34|46.6|163/165|5_3_exonuc_N| RP:PFM:REP 175->261|PF01367|8e-18|48.3|87/100|5_3_exonuc| HM:PFM:NREP 2 HM:PFM:REP 4->172|PF02739|1.3e-59|46.7|167/169|5_3_exonuc_N| HM:PFM:REP 175->264|PF01367|8.9e-32|47.8|90/101|5_3_exonuc| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF02739|IPR020046| GO:PFM GO:0008409|"GO:5'-3' exonuclease activity"|PF02739|IPR020046| GO:PFM GO:0003677|"GO:DNA binding"|PF01367|IPR020047| GO:PFM GO:0008409|"GO:5'-3' exonuclease activity"|PF01367|IPR020047| RP:SCP:NREP 2 RP:SCP:REP 3->172|1a76A2|7e-32|17.2|163/207|c.120.1.2| RP:SCP:REP 177->271|1exnA1|9e-20|24.2|95/105|a.60.7.1| HM:SCP:REP 3->174|1bgxT2|8.5e-46|45.7|162/173|c.120.1.2|1/1|PIN domain-like| HM:SCP:REP 175->291|1bgxT1|8.7e-29|41.4|116/0|a.60.7.1|1/1|5' to 3' exonuclease, C-terminal subdomain| OP:NHOMO 1218 OP:NHOMOORG 937 OP:PATTERN -------------------------------------------------------------------- 1211211111111122222-22112222222222222222212222121111222111112231222222111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111112222222222222222222222222221132132222222222222222222222222222111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111112111111111111111111111111111111111111111111111111111111111-111131111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111121111112112211111111111111111111111111111111111222111222112121111111111111111111111111111112221122112222222222222222222221-1111211111122222222221222222-22222222222222222222222212221222222222322222222222221233323323222111111111111111112111111111111111111111111111111111111111111111111111111222122222222222222222222111111111111111111111111111112-11211111111211111111111111111111 11--11--311-------------------------------------------------------------------------------------------------11-----------------------------------------------------1------1----1-1131111-3272-241121--- ----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- STR:NPRED 294 STR:RPRED 99.3 SQ:SECSTR ccTTcEEEEEHHHHHHHHHHHcccTccccccTTccccHHHHHHHHHHHHHHHTcTTcEEEEEEcccccccccccHHHHHHHHHTcGGGTHHHHHHHHHHHHHHTccEEcEccccHHHHHHHHHHHHHHTcccEEEccccHHHHTTccEEEEcTTTcEEEEcTTcccHHHHHHHTccHHHHHHHHHHHHccTTcTTccTTccHHHHHHHHHTcccGGGGTGGGccccHHHHHHHHccccccccccccccccHHHHHHHHTTTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHTT## DISOP:02AL 1-2| PSIPRED cccccEEEEEcHHHHHHHHHHccccccccccccccEEHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHcccEEEEEccccccccEEEcHHHHHHHHcccHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHEEEEccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc //