[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : exuT
DDBJ      :exuT         hexuronate transporter
Swiss-Prot:EXUT_BACSU   RecName: Full=Hexuronate transporter;

Homologs  Archaea  33/68 : Bacteria  584/915 : Eukaryota  143/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:422 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->301 1pw4A PDBj 3e-14 23.7 %
:RPS:PDB   69->192 2d33D PDBj 1e-06 8.9 %
:RPS:SCOP  9->380 1pw4A  f.38.1.1 * 6e-22 17.8 %
:HMM:SCOP  1->411 1pw4A_ f.38.1.1 * 2.3e-86 28.8 %
:RPS:PFM   13->277 PF07690 * MFS_1 6e-33 32.1 %
:HMM:PFM   13->369 PF07690 * MFS_1 6.6e-61 27.7 343/353  
:HMM:PFM   339->406 PF07690 * MFS_1 2e-08 25.4 67/353  
:BLT:SWISS 1->422 EXUT_BACSU 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13093.1 GT:GENE exuT GT:PRODUCT hexuronate transporter GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1307446..1308714 GB:FROM 1307446 GB:TO 1308714 GB:DIRECTION + GB:GENE exuT GB:PRODUCT hexuronate transporter GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 15849754, 16850406, 8320243, 9579062, 9882655; Product type t: transporter GB:PROTEIN_ID CAB13093.1 GB:DB_XREF GOA:O34456 InterPro:IPR011701 SubtiList:BG13210 UniProtKB/Swiss-Prot:O34456 GB:GENE:GENE exuT LENGTH 422 SQ:AASEQ MFSKDKLPVILFLFLAGVINYLDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFNFLGGVASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKMVNNWFPPTQRASVIGVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWFKFVKEKPQETIKEAPAIKAETSPGEKIPLTFYLKQKTVLFTAFAFFAYNYILFFFLTWFPSYLVDERGLSVESMSVITVIPWILGFIGLAAGGFVSDYVYKKTARKGVLFSRKVVLVTCLFSSAVLIGFAGLVATTAGAVTLVALSVFFLYLTGAIYWAVIQDVVDQNNVGSVGGFMHFLANTAGIIGPALTGFIVDQTGTFSGAFLLAGGLAVFASLAVIRFVRPIIGKPAGTEAENPVSY GT:EXON 1|1-422:0| SW:ID EXUT_BACSU SW:DE RecName: Full=Hexuronate transporter; SW:GN Name=exuT; Synonyms=yjmG; OrderedLocusNames=BSU12360; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->422|EXUT_BACSU|0.0|100.0|422/422| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 9 TM:REGION 9->31| TM:REGION 45->67| TM:REGION 78->100| TM:REGION 150->172| TM:REGION 219->241| TM:REGION 252->274| TM:REGION 294->316| TM:REGION 322->344| TM:REGION 384->406| SEG 308->325|gfaglvattagavtlval| SEG 382->400|fsgafllagglavfaslav| BL:PDB:NREP 1 BL:PDB:REP 9->301|1pw4A|3e-14|23.7|283/434| RP:PDB:NREP 1 RP:PDB:REP 69->192|2d33D|1e-06|8.9|123/499| RP:PFM:NREP 1 RP:PFM:REP 13->277|PF07690|6e-33|32.1|265/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 13->369|PF07690|6.6e-61|27.7|343/353|MFS_1| HM:PFM:REP 339->406|PF07690|2e-08|25.4|67/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 9->380|1pw4A|6e-22|17.8|365/434|f.38.1.1| HM:SCP:REP 1->411|1pw4A_|2.3e-86|28.8|400/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 4200 OP:NHOMOORG 760 OP:PATTERN ----1-1-3333334-2------3------11------1211-21-12--312-121-112132---- 77I-4-22225122---11-11--2711111122221A7B--11121-111-3251-2-111113-A361--111-11--1-2----1442211-----113-1-3-92A111111111111111--1---111---1111-------11-----------------1-1--------------------2428888886996888579-2CC368671-3211111111-723555554533555347443431--22-21--11234211212--11---------------------------------------------1-251111111112-2113111----------C722321417----1--1-1E77G-----729551-11811133333343434-34E22I5C-14-9224132522-1A2653--11111---747777771773-13-----1-------1111111111111-----28K421---3bbffedF8776bbdZAAA96BXJSDNI9-1EBE1-311B2419545--1-132------------1-2111-11-2111213212112-111-123-3--1--11-1---1----------1-112282-2--53-1-----22122---2-----------------D7A64A1A99CAABBAB-9B9BCA9BCA8BBDDADDBHMI76234IBGCHDIHHEDDFDCDH854988A1-888888887888--1-343446665-1-11---14111111---2FFBBE2812-92CA9A6EFI5EGJJ2A88513334231-221322222131222233333333--------33--11------------------------------------21-1-11111-41 --11222-1------352-11214452------4211111-11---12126867231---11------------2---------2-21-1-2511-11-----324-232QEHCKB77443784H9183KlB-D8I4532B26A837236C32L55758BJK8DRF9YIFhPVF62873Z754A748CC-C42122131 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 69.4 SQ:SECSTR ########HHHHHHHHHHHHHHHHTcHHHHHHHTTccTTTccccHHHHHHHHHHHHHHHHHHHHHHHHcccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHHcccccccHHccccTTTcccccTHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTcHHHHHHHHHHHHHHHHHHT######################################################################################################################### DISOP:02AL 188-208, 410-411, 413-422| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccc //