[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : fhuC
DDBJ      :fhuC         ferrichrome ABC transporter (ATP-binding protein)
Swiss-Prot:FHUC_BACSU   RecName: Full=Iron(3+)-hydroxamate import ATP-binding protein fhuC;         EC=3.6.3.34;AltName: Full=Iron(III)-hydroxamate import ATP-binding protein fhuC;AltName: Full=Ferrichrome transport ATP-binding protein fhuC;AltName: Full=Ferric hydroxamate uptake protein C;

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:269 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->239 2nq2C PDBj 1e-29 33.6 %
:RPS:PDB   4->229 3dmdC PDBj 3e-40 9.8 %
:RPS:SCOP  14->237 1l7vC  c.37.1.12 * 2e-37 30.0 %
:HMM:SCOP  9->222 1ii8.1 c.37.1.12 * 2.5e-63 35.1 %
:RPS:PFM   43->168 PF00005 * ABC_tran 6e-12 35.3 %
:HMM:PFM   43->168 PF00005 * ABC_tran 3.9e-22 31.6 114/118  
:HMM:PFM   20->63 PF00006 * ATP-synt_ab 6.8e-06 32.6 43/215  
:BLT:SWISS 1->269 FHUC_BACSU e-153 100.0 %
:PROS 140->154|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15335.1 GT:GENE fhuC GT:PRODUCT ferrichrome ABC transporter (ATP-binding protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3415387..3416196) GB:FROM 3415387 GB:TO 3416196 GB:DIRECTION - GB:GENE fhuC GB:PRODUCT ferrichrome ABC transporter (ATP-binding protein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 15802251, 8388528, 8596459; Product type t : transporter GB:PROTEIN_ID CAB15335.1 GB:DB_XREF GOA:P49938 HSSP:1L7V InterPro:IPR003593 SubtiList:BG11390 UniProtKB/Swiss-Prot:P49938 GB:GENE:GENE fhuC LENGTH 269 SQ:AASEQ MNSLSTEQLGIGYGDRVIVEDLNISIPKGKITTLIGPNGCGKSTILKTMSRIMRSHAGAVYLNGKAIHKMSTKDIAKDMAILPQTPEAPSGLTVHELVSYGRFPHQSGFGRLNDEDRRIIKWALEETGMAEYAERPIEALSGGQRQRVWIAMALAQGTELLLLDEPTTYLDLAHQLEILQLLDRLNKEQGRTILMVIHDLNHAARFSHYMIALKKGTVIKEGTALEVMTPDILKQVFQIDAEIVTDPRTNKPVCLTYDLIKNEKELVTV GT:EXON 1|1-269:0| SW:ID FHUC_BACSU SW:DE RecName: Full=Iron(3+)-hydroxamate import ATP-binding protein fhuC; EC=3.6.3.34;AltName: Full=Iron(III)-hydroxamate import ATP-binding protein fhuC;AltName: Full=Ferrichrome transport ATP-binding protein fhuC;AltName: Full=Ferric hydroxamate uptake protein C; SW:GN Name=fhuC; OrderedLocusNames=BSU33290; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase;Ion transport; Iron; Iron transport; Membrane; Nucleotide-binding;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->269|FHUC_BACSU|e-153|100.0|269/269| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0006826|"GO:iron ion transport"|Iron transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 140->154|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 3->239|2nq2C|1e-29|33.6|223/251| RP:PDB:NREP 1 RP:PDB:REP 4->229|3dmdC|3e-40|9.8|205/318| RP:PFM:NREP 1 RP:PFM:REP 43->168|PF00005|6e-12|35.3|119/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 43->168|PF00005|3.9e-22|31.6|114/118|ABC_tran| HM:PFM:REP 20->63|PF00006|6.8e-06|32.6|43/215|ATP-synt_ab| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 14->237|1l7vC|2e-37|30.0|213/231|c.37.1.12| HM:SCP:REP 9->222|1ii8.1|2.5e-63|35.1|211/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 50833 OP:NHOMOORG 1174 OP:PATTERN TTNBQJKLZYXUYUcSlJRRNROWwSVhkZkVHBEBEBHHIFCSXPVjLS**i8ReRWaPRMMHZ29C TatN*gbhqqrceVZSTML-LfBBX*NNNNNQsporu***V*T*x*zdmofT***QXiFGwz*l*s****caYYYucaZQ*dnB8DACWVTO6MGJI--GEUKMHZMaRP8899998AC9BBBBITOKUaLMXTWQnww**LLL*brlnvedkfhSTPKNLQJfdan***ZLOJKLMKNJLFKnWeRPti9Yiv************************jmz**rr***wxw**YlmkikjejkmmlkiZgdbf*idb**bRcXh*yQR**cZTXqlfijpoturnxxwvuwtvsrvysvtcdedccfehfecd*srdcdusvpr*x*********k*mw***apok*ulyr*jpVO**rjYcioTajdroQdbeOfSQQHNROOPZV***VQw****************-ov*ng*n***QB**************JJK**********UTUUUUUUnchKQmb*776556666567667866776966A85A6ICCEBF***************z********k********BNzzs*lvmt******blkOZHPlZJKKIKJIOPRZqnd**SiYxlXkvecmHdeaWXViWZUXUUsya*HMMNEJJKLIECACDCDCCDHOGFKPOsswUrVdLWLxSaefbOYhaYYWUaedYed6-CJTSM22-111****Z************-*************z***z******mpiuvqsrtttttrqtqsr*zuv****W3************34LJCDBCDORPPRL*r*dbbbZcKOUONXQWeORTSRIUJPVnez*vzv***p***yl***CEECDEEDEMirq*ttuut*****QONKMLKIKLA88876NTRRMMLM8A8AAAAA*BaBB9BF-ABE9GFCIJKCIOEFEAAAckxRYs*porDYN 3354jjI1bKAEWkUIFJECNQGSIVKGGDEBDNJLALFHHJIDECIFIQLIbQIHK89CAAEAE7AC5AD8BCFBE3ADACB9DD59-PVDFLGNCCBID7FQPN7NoqrbiWpfiOHIELXKywA*E**t3xXtJKLDlDLlWERKGDeDC*EfSOtMj*MtSeA*fj*jgcRDHFI*HGBINser*J*uNPydmqS ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 268-269| PSIPRED ccEEEEEEEEEEEccEEEEEccEEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEccEEcccccHHHHHHHcccccccccccccccHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccHHccHHHHHHHHHHHHHHccccEEEEEccHHHccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHcHHHHHHHHcccEEEEEcccccEEEEEEcccccccccEEcc //