[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : folEA
DDBJ      :folEA        GTP cyclohydrolase I
Swiss-Prot:GCH1_BACSU   RecName: Full=GTP cyclohydrolase 1;         EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I;         Short=GTP-CH-I;

Homologs  Archaea  22/68 : Bacteria  714/915 : Eukaryota  186/199 : Viruses  2/175   --->[See Alignment]
d.96.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->187 1is7A PDBj 2e-46 53.9 %
:RPS:PDB   1->190 1a9cA PDBj 2e-56 36.5 %
:RPS:SCOP  2->190 1a8rA  d.96.1.1 * 4e-70 37.2 %
:HMM:SCOP  2->188 1fb1A_ d.96.1.1 * 2e-81 63.4 %
:RPS:PFM   84->170 PF01227 * GTP_cyclohydroI 4e-30 66.3 %
:HMM:PFM   84->170 PF01227 * GTP_cyclohydroI 1.8e-40 70.9 86/86  
:BLT:SWISS 1->190 GCH1_BACSU e-107 100.0 %
:PROS 65->81|PS00859|GTP_CYCLOHYDROL_1_1
:PROS 114->124|PS00860|GTP_CYCLOHYDROL_1_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14194.1 GT:GENE folEA GT:PRODUCT GTP cyclohydrolase I GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2384783..2385355) GB:FROM 2384783 GB:TO 2385355 GB:DIRECTION - GB:GENE folEA GB:PRODUCT GTP cyclohydrolase I GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 1551827, 17032654; Product type e: enzyme GB:PROTEIN_ID CAB14194.1 GB:DB_XREF GOA:P19465 HSSP:1FB1 InterPro:IPR018234 SubtiList:BG10277 UniProtKB/Swiss-Prot:P19465 GB:GENE:GENE folEA LENGTH 190 SQ:AASEQ MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFGENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARAEVLEHIKRQD GT:EXON 1|1-190:0| SW:ID GCH1_BACSU SW:DE RecName: Full=GTP cyclohydrolase 1; EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I; Short=GTP-CH-I; SW:GN Name=folE; Synonyms=mtrA; OrderedLocusNames=BSU22780; SW:KW Complete proteome; GTP-binding; Hydrolase; Metal-binding;Nucleotide-binding; One-carbon metabolism; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->190|GCH1_BACSU|e-107|100.0|190/190| GO:SWS:NREP 5 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| PROS 65->81|PS00859|GTP_CYCLOHYDROL_1_1|PDOC00672| PROS 114->124|PS00860|GTP_CYCLOHYDROL_1_2|PDOC00672| BL:PDB:NREP 1 BL:PDB:REP 3->187|1is7A|2e-46|53.9|178/194| RP:PDB:NREP 1 RP:PDB:REP 1->190|1a9cA|2e-56|36.5|189/221| RP:PFM:NREP 1 RP:PFM:REP 84->170|PF01227|4e-30|66.3|86/86|GTP_cyclohydroI| HM:PFM:NREP 1 HM:PFM:REP 84->170|PF01227|1.8e-40|70.9|86/86|GTP_cyclohydroI| RP:SCP:NREP 1 RP:SCP:REP 2->190|1a8rA|4e-70|37.2|188/221|d.96.1.1| HM:SCP:REP 2->188|1fb1A_|2e-81|63.4|186/196|d.96.1.1|1/1|Tetrahydrobiopterin biosynthesis enzymes-like| OP:NHOMO 1097 OP:NHOMOORG 924 OP:PATTERN ---1-11111111111-111111-1--1--------------------------------------11 1111211111111111111-1111211111121111213322211111111111111111113111211111---111111211111111111111---11122413111--------------1111111111111111111111322122211111111112111221211211111111111111--12111111111111111111111111111111---11111111--------------------1--1--11-1-1111--1--1--111111111111111111111111111111111111111111-1111-1-111111111-1-111111111-1-111-11221111--11111--11111211311111121221121111211111111111111111311111111111112111111111----------11111111111112121121111111--1111111111111----1131111----1111212323322113333-11211111-1--1111111111111112---2----------111-1-----------------------111111--1111111111111111111111111--1111113-11-11111121111111121111--11-11-----11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111111111-11111111111111-11111111111111122222322221222222111111111-1111111111121111111111111111----111111-----------------------------------------------1- 11--11--1---111221112112122111111111211111111-2111121211221111111111111111111-1111111111-11121111111111111-1113143411111111111131494-312111111111111111111111222211111-321511211111F1111121221211121111 -------------------1-----------------------------------------------------------------------------------------------------1----------------------------------------------------- STR:NPRED 190 STR:RPRED 100.0 SQ:SECSTR cHHHHHHHHHHHHHHHHHHTTccTTcTTGGGHHHHHHHHHHHTTGGGcGGGcccccEEcTTcccccEEEEEEEEEEEETTTccEEEEEEEEEEcccccEEEcHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHTcccEEEEEEEEEHHHHccTTccccccEEEEEEcTHHHHcHHHHHHHHHHccccc DISOP:02AL 1-4, 188-190| PSIPRED cccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccEEEEEcEEEEEEcccccccEEEEEEEEEEccccEEEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEcccHHHHHHHHHHHHccc //