[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : gerBB
DDBJ      :gerBB        component of germinant receptor B
Swiss-Prot:GERBB_BACSU  RecName: Full=Spore germination protein B2;

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->120 3h6bC PDBj 3e-04 24.8 %
:RPS:PFM   12->329 PF03845 * Spore_permease 1e-22 27.8 %
:HMM:PFM   7->331 PF03845 * Spore_permease 8.4e-105 38.4 320/320  
:BLT:SWISS 1->368 GERBB_BACSU e-177 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15598.2 GT:GENE gerBB GT:PRODUCT component of germinant receptor B GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3690269..3691375 GB:FROM 3690269 GB:TO 3691375 GB:DIRECTION + GB:GENE gerBB GB:PRODUCT component of germinant receptor B GB:FUNCTION 16.12: Sense GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15774895, 15849754, 16352818, 16850406; Product type rc: receptor GB:PROTEIN_ID CAB15598.2 GB:DB_XREF GOA:P39570 InterPro:IPR004761 SubtiList:BG10641 UniProtKB/Swiss-Prot:P39570 GB:GENE:GENE gerBB LENGTH 368 SQ:AASEQ MRKSEHKLTFMQTLIMISSTLIGAGVLTLPRSAAETGSPSGWLMILLQGVIFIIIVLLFLPFLQKNSGKTLFKLNSIVAGKFIGFLLNLYICLYFIGIVCFQARILGEVVGFFLLKNTPMAVVVFIFLAVAIYHVGGGVYSIAKVYAYIFPITLIIFMMLLMFSFRLFQLDFIRPVFEGGYQSFFSLFPKTLLYFSGFEIIFYLVPFMRDPKQVKKAVALGIATSTLFYSITLLIVIGCMTVAEAKTVTWPTISLIHALEVPGIFIERFDLFLQLTWTAQQFACMLGSFKGAHIGLTEIFHLKNKNNAWLLTAMLAATFFITMYPKDLNDVFYYGTLLGYAFLIVITIPFFVWFLSWIQKKIGRGQLQ GT:EXON 1|1-368:0| SW:ID GERBB_BACSU SW:DE RecName: Full=Spore germination protein B2; SW:GN Name=gerBB; OrderedLocusNames=BSU35810; SW:KW Amino-acid transport; Cell membrane; Complete proteome; Germination;Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|GERBB_BACSU|e-177|100.0|368/368| GO:SWS:NREP 5 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 9 TM:REGION 10->32| TM:REGION 41->63| TM:REGION 76->98| TM:REGION 110->132| TM:REGION 144->166| TM:REGION 219->241| TM:REGION 269->291| TM:REGION 306->328| TM:REGION 335->357| SEG 45->64|illqgvifiiivllflpflq| SEG 121->132|avvvfiflavai| SEG 149->170|ifpitliifmmllmfsfrlfql| BL:PDB:NREP 1 BL:PDB:REP 6->120|3h6bC|3e-04|24.8|113/411| RP:PFM:NREP 1 RP:PFM:REP 12->329|PF03845|1e-22|27.8|313/319|Spore_permease| HM:PFM:NREP 1 HM:PFM:REP 7->331|PF03845|8.4e-105|38.4|320/320|Spore_permease| GO:PFM:NREP 2 GO:PFM GO:0009847|"GO:spore germination"|PF03845|IPR004761| GO:PFM GO:0016021|"GO:integral to membrane"|PF03845|IPR004761| OP:NHOMO 101 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--1-132212313342144232211--31--------74------------------------------------------------------------------------------------------132--2222222-2---221-------------11----11--111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 30.7 SQ:SECSTR #####ccccHHHHHHHHHHHHccccTTHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccTHHHHHHHH##ccHHHHHHHHHHHHHHHHHHHHHHHHGGGcccccccccccT######################################################################################################################################################################################################################################################## DISOP:02AL 368-369| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccccccc //