[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : gerD
DDBJ      :gerD         lipoprotein with a role in spores' rapid response to nutrient germinants
Swiss-Prot:GERD_BACSU   RecName: Full=Spore germination protein gerD;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:185 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   99->158 PF05595 * DUF771 0.00034 23.7 59/91  
:HMM:PFM   71->119 PF07700 * HNOB 0.00046 24.5 49/171  
:BLT:SWISS 1->185 GERD_BACSU e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB11931.1 GT:GENE gerD GT:PRODUCT lipoprotein with a role in spores' rapid response to nutrient germinants GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(158515..159072) GB:FROM 158515 GB:TO 159072 GB:DIRECTION - GB:GENE gerD GB:PRODUCT lipoprotein with a role in spores' rapid response to nutrient germinants GB:FUNCTION 16.13: Shape 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 17122337, 10618233, 10376819; Product type f: factor GB:PROTEIN_ID CAB11931.1 GB:DB_XREF GOA:P16450 SubtiList:BG10644 UniProtKB/Swiss-Prot:P16450 GB:GENE:GENE gerD LENGTH 185 SQ:AASEQ MSKAKTLLMSCFLLLSVTACAPKDQAADMDYDQTKKMVVDILKTDDGKKAIKELLNDDAMNEALVIDQDAIKGTIEKTLTSKKGEEFWKNIFEDTDFAEGFAKTLQTEHEKVIKKLMKDPDYQKMLMSVMQDPGMDKKYSQLAKSQEFRSYLEEVINETLSSPLYKKQFEDELKKAAKDTAKESE GT:EXON 1|1-185:0| SW:ID GERD_BACSU SW:DE RecName: Full=Spore germination protein gerD;Flags: Precursor; SW:GN Name=gerD; OrderedLocusNames=BSU01550; SW:KW Cell membrane; Complete proteome; Germination; Lipoprotein; Membrane;Palmitate; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|GERD_BACSU|e-103|100.0|185/185| GO:SWS:NREP 2 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| HM:PFM:NREP 2 HM:PFM:REP 99->158|PF05595|0.00034|23.7|59/91|DUF771| HM:PFM:REP 71->119|PF07700|0.00046|24.5|49/171|HNOB| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111--------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 22-31, 175-185| PSIPRED cHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccc //