[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ggt
DDBJ      :ggt          membrane bound gamma-glutamyltranspeptidase
Swiss-Prot:GGT_BACSU    RecName: Full=Gamma-glutamyltranspeptidase;         EC=2.3.2.2;Contains:  RecName: Full=Gamma-glutamyltranspeptidase large chain;Contains:  RecName: Full=Gamma-glutamyltranspeptidase small chain;Flags: Precursor;

Homologs  Archaea  26/68 : Bacteria  498/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
d.153.1
:587 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->394 2v36A PDBj 0.0 99.7 %
:BLT:PDB   403->585 2v36D PDBj e-104 100.0 %
:RPS:PDB   31->579 2e0wA PDBj e-135 38.4 %
:RPS:SCOP  31->579 2dbu.1  d.153.1.6 * e-144 40.5 %
:HMM:SCOP  38->575 2nqo.1 d.153.1.6 * 1.3e-182 45.8 %
:RPS:PFM   62->577 PF01019 * G_glu_transpept e-114 46.1 %
:HMM:PFM   62->577 PF01019 * G_glu_transpept 3.5e-181 45.1 497/510  
:BLT:SWISS 1->587 GGT_BACSU 0.0 100.0 %
:PROS 403->427|PS00462|G_GLU_TRANSPEPTIDASE
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13724.1 GT:GENE ggt GT:PRODUCT membrane bound gamma-glutamyltranspeptidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2004677..2006440 GB:FROM 2004677 GB:TO 2006440 GB:DIRECTION + GB:GENE ggt GB:PRODUCT membrane bound gamma-glutamyltranspeptidase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 8763966; Product type e : enzyme GB:PROTEIN_ID CAB13724.1 GB:DB_XREF GOA:P54422 InterPro:IPR000101 PDB:2V36 SubtiList:BG11838 UniProtKB/Swiss-Prot:P54422 GB:GENE:GENE ggt LENGTH 587 SQ:AASEQ MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKVEGQTTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQPNKRPLSSMTPTILFKDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSSYRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDHENGTFKGVADSSRNGAAIGINLKRK GT:EXON 1|1-587:0| SW:ID GGT_BACSU SW:DE RecName: Full=Gamma-glutamyltranspeptidase; EC=2.3.2.2;Contains: RecName: Full=Gamma-glutamyltranspeptidase large chain;Contains: RecName: Full=Gamma-glutamyltranspeptidase small chain;Flags: Precursor; SW:GN Name=ggt; OrderedLocusNames=BSU18410; SW:KW 3D-structure; Acyltransferase; Complete proteome;Glutathione biosynthesis; Secreted; Signal; Transferase; Zymogen. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->587|GGT_BACSU|0.0|100.0|587/587| GO:SWS:NREP 4 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0006750|"GO:glutathione biosynthetic process"|Glutathione biosynthesis| GO:SWS GO:0005576|"GO:extracellular region"|Secreted| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 403->427|PS00462|G_GLU_TRANSPEPTIDASE|PDOC00404| TM:NTM 1 TM:REGION 4->25| SEG 7->22|vcltallsvllvagsv| SEG 87->98|mmsgiggggfmm| BL:PDB:NREP 2 BL:PDB:REP 34->394|2v36A|0.0|99.7|359/359| BL:PDB:REP 403->585|2v36D|e-104|100.0|183/183| RP:PDB:NREP 1 RP:PDB:REP 31->579|2e0wA|e-135|38.4|485/496| RP:PFM:NREP 1 RP:PFM:REP 62->577|PF01019|e-114|46.1|497/504|G_glu_transpept| HM:PFM:NREP 1 HM:PFM:REP 62->577|PF01019|3.5e-181|45.1|497/510|G_glu_transpept| GO:PFM:NREP 1 GO:PFM GO:0003840|"GO:gamma-glutamyltransferase activity"|PF01019|IPR000101| RP:SCP:NREP 1 RP:SCP:REP 31->579|2dbu.1|e-144|40.5|528/549|d.153.1.6| HM:SCP:REP 38->575|2nqo.1|1.3e-182|45.8|518/0|d.153.1.6|1/1|N-terminal nucleophile aminohydrolases (Ntn hydrolases)| OP:NHOMO 1637 OP:NHOMOORG 705 OP:PATTERN 111-1-1111111111-1----1----11111-----------------------------1111--1 -34-2--1111-1-11122-21--2422222112221-22----11---11-111--3--111-222231------------2--2-------------1-11122-221--------------------------11122---13124-1111112111-1111-31112--1---------11111---1-2-1-11----1-----112212---111-3--------31-11111111111111-2111-----------------------------------------------------------------------2--------------1-----------1----11-----1-------2-4--3332-----1165611543432----------1-33533334222-5224222332114112132121223333333333313332123------------------------------1132147645655555233334454333323554434412223325225131454621---1--11111111-11-1------11-1--1----------111113--1------111-1-1111111-----11111411223122222211122221211222---14-1------11321221111111111-111111111111111111122222111111111111111111131-11111--1-1-111-2111---2-----111111122---11----------111111211111333322241222321221111111112-11122122111--22333331111111---1221111--------------------------------------1---1----1- ------2-----12232232222434222222243322222222223344334333312222223121-2112121111222222222-242224333332234231233J5C67843122233512B9pxH-854112232223121223214343356ED59764839579E32-11H---2212182612332111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 557 STR:RPRED 94.9 SQ:SECSTR ##############################cccccccTcccEEEcccEEEEccHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHcTTTcccccEEEEEEEcTTccEEEEEEEcccccccccTTTccTTccccHHHHHHHTcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcEEccHHHHHHHHHTHHHHcTTHHHHHHEETTEEccTTcEEccHHHHHHHHHHHHHcTHHHHHcHHHHHHHHHHHHccccccHHHHHTcccEEEccEEEEETTEEEEEccTTcccHHHHHHHHHHHHTcccccccTTcHHHHHHHHHHHHHHHHHHGGGcccGcTTGccHGGGGcHHHHHHHHHHcccccccGcHHHHcccccccGGGTcccccccccccccccEEEEEEcTTccEEEEEEEcccTTTTccccGGGcccccccGGGcccccccTTccccccccccccccEEEEETTEEEEEEccccTTHHHHHHHHHHHHHHTccccHHHHHHcccEEccTTTcEEEcccccHHHHHHHHHTTccEEEccccccccEEEEEcTTTccEEEEEcTTcTTcEcccccccc DISOP:02AL 31-36, 132-138| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEcccccHHHccHHHHHccccccccccccccccccEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEccHHHHHHHHHHHHHHcccccHHHHcccccccccccEEEcHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccHHHHccccEEEEccEEEEccccEEEEccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccHHcccccccccccccEEEEEEcccccEEEEEEccccccccEEEEccccEEEEcccccccccccccccccccccccHHHcHHHEEEcccEEEEEEcccccHHHHHHHHHHHHHHHccccHHHHHccccEEccccccEEEEccccHHHHHHHHHcccEEEEEccccccEEEEEEEccccEEEEEEEEccccEEEEEEEEEc //