[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glcK
DDBJ      :glcK         glucose kinase
Swiss-Prot:GLK_BACSU    RecName: Full=Glucokinase;         EC=2.7.1.2;AltName: Full=Glucose kinase;

Homologs  Archaea  20/68 : Bacteria  568/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:321 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->311 2qm1B PDBj 2e-49 41.7 %
:RPS:PDB   5->314 2aa4A PDBj 2e-42 26.3 %
:RPS:SCOP  8->128 1woqA1  c.55.1.10 * 5e-21 28.1 %
:RPS:SCOP  148->311 1z05A2  c.55.1.10 * 1e-29 29.0 %
:HMM:SCOP  1->319 1sz2A1 c.55.1.7 * 1.9e-66 39.7 %
:RPS:PFM   8->192 PF00480 * ROK 2e-31 43.3 %
:HMM:PFM   8->192 PF00480 * ROK 7.1e-49 41.3 179/179  
:BLT:SWISS 1->321 GLK_BACSU e-171 100.0 %
:PROS 137->164|PS01125|ROK
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14416.2 GT:GENE glcK GT:PRODUCT glucose kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2570606..2571571) GB:FROM 2570606 GB:TO 2571571 GB:DIRECTION - GB:GENE glcK GB:PRODUCT glucose kinase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 15018644, 15050034, 9620975; Product type e: enzyme GB:PROTEIN_ID CAB14416.2 GB:DB_XREF GOA:P54495 InterPro:IPR004654 SubtiList:BG11685 UniProtKB/Swiss-Prot:P54495 GB:GENE:GENE glcK LENGTH 321 SQ:AASEQ MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKPKHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGEMWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKTGCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAKHLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGNDAGVIGGAWIAKNEWLKHQNC GT:EXON 1|1-321:0| SW:ID GLK_BACSU SW:DE RecName: Full=Glucokinase; EC=2.7.1.2;AltName: Full=Glucose kinase; SW:GN Name=glcK; Synonyms=yqgR; OrderedLocusNames=BSU24850; SW:KW ATP-binding; Complete proteome; Cytoplasm; Glycolysis; Kinase;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->321|GLK_BACSU|e-171|100.0|321/321| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 137->164|PS01125|ROK|PDOC00866| SEG 132->146|vilvtlgtgvgggii| SEG 287->297|aaqaadisiaa| BL:PDB:NREP 1 BL:PDB:REP 8->311|2qm1B|2e-49|41.7|300/321| RP:PDB:NREP 1 RP:PDB:REP 5->314|2aa4A|2e-42|26.3|285/289| RP:PFM:NREP 1 RP:PFM:REP 8->192|PF00480|2e-31|43.3|180/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 8->192|PF00480|7.1e-49|41.3|179/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 8->128|1woqA1|5e-21|28.1|121/129|c.55.1.10| RP:SCP:REP 148->311|1z05A2|1e-29|29.0|162/197|c.55.1.10| HM:SCP:REP 1->319|1sz2A1|1.9e-66|39.7|295/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 1534 OP:NHOMOORG 634 OP:PATTERN --1-1-----------11---1--1111111--------------111-------------111--11 245-D111111111-------2---4------1---14773113755153217471-6113574565C97411114552111211111224216-1---11----12314--------------11112211111212245111521111111--1111111111112221-1-----1----131--45-31322222243223222346334222233516217778865811111111111111111111222122111-14322432121112352222333211322333232323333333333333222111322221-282222222223232213333121-212-111--11511265521221132--------1------------11111111111-11111111231-733433158732----112-2122-2111111111---111----------------------------------------------------------------------------------1131----111--------------11----1---------11212111111111--2------------------------1--335-1----121------12221-1--1-2--1---1------54633435557566655-5555556555566445444666332235455555555545455643555552-533333323333-------------1--1-222131-22221332-----------1-----------------321424322144355555533222-1--------------1111111111-111-1--1----1--------111-21-1----1341125233-12 --------------------------------------------------------------------------------------------------------------3111121111--11321113B1-114--11111111-11-111111111-----------------------------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 99.1 SQ:SECSTR cccEcEEEEEEcccEEEEEEEcTTccEEEEEEEEccccHHHHHHHHHHHHTTTGGGTTTTccEccEEEEEEccEEETTEEcccGGGGGGGTTccHHHHHHHHHcccEEEEEHHHHHHHHHHHTccTTccccEEEEEEcccEEEEEEETTEEEccTTcccccGGGcccccTTccccTTcccccHHHHHcHHHHHHTccGGGTTcccccTccccccccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHTcTTHHHHHHHHHHTTccGGGHHTccEEEEccccccHHHHHHHHHHHccTTcc### PSIPRED ccccEEEEEEEcccEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEccEEEEcccEEEEEccccccccccHHHHHHHHHcccEEEEEHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEccEEEcccccccccccEEEEcccccccccccccccHHHHHcHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHccHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHcccc //