[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glnH
DDBJ      :glnH         glutamine ABC transporter (glutamine-binding lipoprotein)
Swiss-Prot:GLNH_BACSU   RecName: Full=ABC transporter glutamine-binding protein glnH;Flags: Precursor;

Homologs  Archaea  21/68 : Bacteria  685/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->266 2v25A PDBj 5e-30 33.6 %
:RPS:PDB   14->271 2a5sA PDBj 4e-37 17.9 %
:RPS:SCOP  37->272 1xt8A1  c.94.1.1 * 8e-43 28.2 %
:HMM:SCOP  1->272 2a5sA1 c.94.1.1 * 9.7e-71 42.6 %
:RPS:PFM   90->268 PF00497 * SBP_bac_3 3e-31 43.8 %
:HMM:PFM   48->268 PF00497 * SBP_bac_3 7.7e-64 41.2 216/225  
:HMM:PFM   1->21 PF08085 * Entericidin 0.00014 42.9 21/42  
:BLT:SWISS 1->273 GLNH_BACSU e-144 100.0 %
:PROS 71->84|PS01039|SBP_BACTERIAL_3
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14685.1 GT:GENE glnH GT:PRODUCT glutamine ABC transporter (glutamine-binding lipoprotein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 2803108..2803929 GB:FROM 2803108 GB:TO 2803929 GB:DIRECTION + GB:GENE glnH GB:PRODUCT glutamine ABC transporter (glutamine-binding lipoprotein) GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 1856180; Product type lp: lipoprotein GB:PROTEIN_ID CAB14685.1 GB:DB_XREF GOA:O34563 HSSP:1WDN InterPro:IPR018313 SubtiList:BG11486 UniProtKB/Swiss-Prot:O34563 GB:GENE:GENE glnH LENGTH 273 SQ:AASEQ MKKIFSLALISLFAVILLAACGSKGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFGLKNPSSGEIEGFDIDIAKQIAKDILGDEKKAQFKEVTSKTRIPMLQNGDIDAIVATMTITEERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEASVLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQSALAKEINASLKKMKSDGRYDEIYKKWIKEDPAE GT:EXON 1|1-273:0| SW:ID GLNH_BACSU SW:DE RecName: Full=ABC transporter glutamine-binding protein glnH;Flags: Precursor; SW:GN Name=glnH; OrderedLocusNames=BSU27440; SW:KW Amino-acid transport; Cell membrane; Complete proteome; Lipoprotein;Membrane; Palmitate; Signal; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->273|GLNH_BACSU|e-144|100.0|273/273| GO:SWS:NREP 4 GO:SWS GO:0006865|"GO:amino acid transport"|Amino-acid transport| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 71->84|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 4->21| SEG 73->84|didiakqiakdi| BL:PDB:NREP 1 BL:PDB:REP 39->266|2v25A|5e-30|33.6|223/231| RP:PDB:NREP 1 RP:PDB:REP 14->271|2a5sA|4e-37|17.9|251/278| RP:PFM:NREP 1 RP:PFM:REP 90->268|PF00497|3e-31|43.8|178/222|SBP_bac_3| HM:PFM:NREP 2 HM:PFM:REP 48->268|PF00497|7.7e-64|41.2|216/225|SBP_bac_3| HM:PFM:REP 1->21|PF08085|0.00014|42.9|21/42|Entericidin| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 37->272|1xt8A1|8e-43|28.2|234/248|c.94.1.1| HM:SCP:REP 1->272|2a5sA1|9.7e-71|42.6|251/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3091 OP:NHOMOORG 709 OP:PATTERN -----1----------1------12--11-1111----42542-11-3----1----1------1--- ----432322232221111-1511181111116444349A-5442121221-434121--111-64364617555655212-1--------------------------1-------------------1--2---111221111-34554462222111---14-14462-111---111--1421111--243444446544554452121544453224233333333831111111111111111111245366565456446655264573222444433336666677776667333223333333226687766651455A4435555232333323331311-3113166-5121-211111127---111-43223-1C63222322225564547667I-118117176B1-JFFAA8B9BDBDE6---117535633411111111222111-4------------11--111111111--1-1---1-5B997HLLKLH68998EEEIABBB6AHFI5997-1BBB53944A6AAED126----532222222---13-129-576743A66633-46-31-112-1---4-4435444443121111111-22----573-2-----7-1111--11111111-11-1-5-1--------88AA4997776775777-7787777677777677668DDCBB4338768888888888888C766767731878888887888--31111113333--35722232311111111144444-22441-BA8B8HEH879783A99----------33364444434644-----------------7--------------2-2-------------------------121-113111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 262 STR:RPRED 96.0 SQ:SECSTR ###########EEEEEEcccTTTEEEEcccEEEEccccccccTTcEEEEEEEEcccccccEEEEEGEEEEcHHHHHHHHHHHHHccccccccEETTEEcHHHHHHHTTcccEEcccccccHHHHTTEEEccccEEEcEEEEEETTcccccTTcHcccccEEccTTcHHHHHHHHHHHHHGGGccccHHHHHHHHHTTcccEEEEEHHHHHHHHHTcTTEEEEcccGGGcEEEccEEETTcTTHHHHHHHHHHHHHHTHHHHHHHHHTcccccE DISOP:02AL 271-273| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccEEEEEEccccccEEEEEcccccEEEEHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEEccEEEEEEccccccccHHHHcccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccc //