[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glpF
DDBJ      :glpF         glycerol permease
Swiss-Prot:GLPF_BACSU   RecName: Full=Glycerol uptake facilitator protein;

Homologs  Archaea  14/68 : Bacteria  478/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
f.19.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->238 1fx8A PDBj 7e-21 34.6 %
:RPS:PDB   56->230 2b5fD PDBj 3e-27 27.3 %
:RPS:SCOP  6->238 1fx8A  f.19.1.1 * 3e-42 35.7 %
:HMM:SCOP  1->238 1fx8A_ f.19.1.1 * 3e-67 42.6 %
:RPS:PFM   1->230 PF00230 * MIP 2e-39 49.3 %
:HMM:PFM   3->230 PF00230 * MIP 2.6e-52 34.4 209/227  
:BLT:SWISS 1->274 GLPF_BACSU e-140 100.0 %
:PROS 62->70|PS00221|MIP
:TM
:REPEAT 2|7->84|137->216
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12756.1 GT:GENE glpF GT:PRODUCT glycerol permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1002501..1003325 GB:FROM 1002501 GB:TO 1003325 GB:DIRECTION + GB:GENE glpF GB:PRODUCT glycerol permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11929549, 15849754, 16850406; Product type t: transporter GB:PROTEIN_ID CAB12756.1 GB:DB_XREF GOA:P18156 HSSP:1FX8 InterPro:IPR000425 SubtiList:BG10186 UniProtKB/Swiss-Prot:P18156 GB:GENE:GENE glpF LENGTH 274 SQ:AASEQ MTAFWGEVIGTMLLIIFGAGVCAGVNLKKSLSFQSGWIVVVFGWGLGVAMAAYAVGGISGAHLNPALTIALAFVGDFPWKEVPVYIAAQMIGAIIGAVIIYLHYLPHWKSTDDPAAKLGVFSTGPSIPHTFANVLSEVIGTFVLVLGILAIGANQFTEGLNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFLPIPGKGSSNWKYAWVPVVGPILGGSFGGVFYNAAFKGHITSSFWIVSVILVVVLLGLYVYTKSHSAKTLSNSKYI GT:EXON 1|1-274:0| SW:ID GLPF_BACSU SW:DE RecName: Full=Glycerol uptake facilitator protein; SW:GN Name=glpF; OrderedLocusNames=BSU09280; SW:KW Cell membrane; Complete proteome; Glycerol metabolism; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|GLPF_BACSU|e-140|100.0|274/274| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006071|"GO:glycerol metabolic process"|Glycerol metabolism| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 62->70|PS00221|MIP|PDOC00193| TM:NTM 7 TM:REGION 4->26| TM:REGION 34->56| TM:REGION 83->105| TM:REGION 123->145| TM:REGION 157->179| TM:REGION 212->234| TM:REGION 238->259| NREPEAT 1 REPEAT 2|7->84|137->216| SEG 86->100|iaaqmigaiigavii| SEG 244->259|ivsvilvvvllglyvy| BL:PDB:NREP 1 BL:PDB:REP 7->238|1fx8A|7e-21|34.6|228/254| RP:PDB:NREP 1 RP:PDB:REP 56->230|2b5fD|3e-27|27.3|161/230| RP:PFM:NREP 1 RP:PFM:REP 1->230|PF00230|2e-39|49.3|219/227|MIP| HM:PFM:NREP 1 HM:PFM:REP 3->230|PF00230|2.6e-52|34.4|209/227|MIP| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00230|IPR000425| GO:PFM GO:0006810|"GO:transport"|PF00230|IPR000425| GO:PFM GO:0016020|"GO:membrane"|PF00230|IPR000425| RP:SCP:NREP 1 RP:SCP:REP 6->238|1fx8A|3e-42|35.7|230/254|f.19.1.1| HM:SCP:REP 1->238|1fx8A_|3e-67|42.6|235/254|f.19.1.1|1/1|Aquaporin-like| OP:NHOMO 1238 OP:NHOMOORG 639 OP:PATTERN -------1-111111------------1----11--------11-11--------------------- 1221211-----1-2----------2-------111-2------11111111111122--11-1112322-1111111----1----------1----------11-1-2---------------11-1-------11111----1-----------------11-1----------------211-------111111121111211111111111111111212222221-111111111111111111112221221111155112233311144333331123113333232332223223222322323331113333---211111111212----2222-1-11---1--1-1----1-211--1-2-2---------2-1--------------------1---21---11---------------11-1-1---------111111111221------------------------------------11--11--222222122222231222222222---1----------1---1--1---1-2---------------------1-11111-1-11--------1-------------------------------2221-----1------------1--111-1--1-------11121--1111111111121-1111121111112111112333112212222222222222212111111121-211111111111------------------112211-12-21--1111111----2-22221221-22211111111111111-1112-111112122--11111---1111---111111111111111---------1-1111111111111-----------1----- -1--1---312--1153222123333311-1-1111111111111133232212121-----2--112--21-1-22-121--------5213114----111122-22-4586B62221442273284BU6-6492432534341424333234535511-1345-1-1-4841--------21456C1C6--NKVV- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 238 STR:RPRED 86.9 SQ:SECSTR HHGHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHTTTTcccccHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHTTTTcHHcGGGcccccTTccHHHHHHHHHHHHHHHHHHHHTEEcccccEEccHHHHHHHHHHHHHHTTTTcccccHHHHHHHHHHHcHHTHHHHcHHHHHHTTHHHHHHHHHHHHHHHHHHHHTGGGc#################################### DISOP:02AL 271-274| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccHHHHccccccc //