[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glpP
DDBJ      :glpP         glycerol-3-phosphate responding transcription antiterminator
Swiss-Prot:GLPP_BACSU   RecName: Full=Glycerol uptake operon antiterminator regulatory protein;

Homologs  Archaea  0/68 : Bacteria  149/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.29
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->183 1vkfB PDBj 4e-11 31.9 %
:RPS:PDB   120->173 2b4gA PDBj 1e-08 20.4 %
:RPS:SCOP  13->182 1vkfA  c.1.29.1 * 1e-50 27.1 %
:HMM:SCOP  8->183 1vkfA_ c.1.29.1 * 6.5e-71 47.7 %
:RPS:PFM   8->181 PF04309 * G3P_antiterm 5e-43 47.1 %
:HMM:PFM   8->182 PF04309 * G3P_antiterm 4.8e-78 54.9 175/175  
:BLT:SWISS 1->192 GLPP_BACSU e-100 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12755.1 GT:GENE glpP GT:PRODUCT glycerol-3-phosphate responding transcription antiterminator GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1001744..1002322 GB:FROM 1001744 GB:TO 1002322 GB:DIRECTION + GB:GENE glpP GB:PRODUCT glycerol-3-phosphate responding transcription antiterminator GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11929549; Product type r: regulator GB:PROTEIN_ID CAB12755.1 GB:DB_XREF GOA:P30300 InterPro:IPR006699 SubtiList:BG10185 UniProtKB/Swiss-Prot:P30300 GB:GENE:GENE glpP LENGTH 192 SQ:AASEQ MMSFHNQPILPAIRNMKQFDEFLNSSFSYGVILDIHLGQLKGVIKEAQKHGKNMMVHVDLIQGIKHDEYGAEFICQDIKPAGIISTRSNVIAKAKQKKIYAIQRLFLLDTSAMEKSMEFIGKHKPDFIEVLPGIVPSLIQEIKEKTGIPIFAGGFIRTEEDVEQALKAGAVAVTTSNTKLWKKYENFLTESD GT:EXON 1|1-192:0| SW:ID GLPP_BACSU SW:DE RecName: Full=Glycerol uptake operon antiterminator regulatory protein; SW:GN Name=glpP; OrderedLocusNames=BSU09270; SW:KW Complete proteome; Glycerol metabolism; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->192|GLPP_BACSU|e-100|100.0|192/192| GO:SWS:NREP 3 GO:SWS GO:0006071|"GO:glycerol metabolic process"|Glycerol metabolism| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 91->103|iakakqkkiyaiq| BL:PDB:NREP 1 BL:PDB:REP 40->183|1vkfB|4e-11|31.9|138/169| RP:PDB:NREP 1 RP:PDB:REP 120->173|2b4gA|1e-08|20.4|54/312| RP:PFM:NREP 1 RP:PFM:REP 8->181|PF04309|5e-43|47.1|174/175|G3P_antiterm| HM:PFM:NREP 1 HM:PFM:REP 8->182|PF04309|4.8e-78|54.9|175/175|G3P_antiterm| GO:PFM:NREP 3 GO:PFM GO:0009607|"GO:response to biotic stimulus"|PF04309|IPR006699| GO:PFM GO:0030528|"GO:transcription regulator activity"|PF04309|IPR006699| GO:PFM GO:0045449|"GO:regulation of transcription"|PF04309|IPR006699| RP:SCP:NREP 1 RP:SCP:REP 13->182|1vkfA|1e-50|27.1|166/172|c.1.29.1| HM:SCP:REP 8->183|1vkfA_|6.5e-71|47.7|172/0|c.1.29.1|1/1|GlpP-like| OP:NHOMO 180 OP:NHOMOORG 150 OP:PATTERN -------------------------------------------------------------------- ---1------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------11-12122222222112222222111122221112121111113-11111111111111111111----------------1-----------------------------------------------------111111111111212----111111-1-1--1----2--1-1-1111-1------------------------------------1---------------------------------------------------------------------------------------------------1-------11--------1----11----------1---------------------------------------------------------------------------------------------------------------------------------1------111-111111-111211111111111111--11---------------------1111---1------------------------------------------------------------------------------------------------------------------------------------------------------------------11121211--- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 96.9 SQ:SECSTR cTcEEEEccTTTT#cEEEEEEEETTTTEEEEEccHHHHTTcTTcEEEEEEccTTcccTTcTTcEEcccHHHHTTcccEEccccEEEEEcEEEcGGcTTTTcccTEEEEcTTccHHcccEGGEEEEEEGGGHHHHHHHHHHHHHHcTTcEEEEEcccccHHHHHHHHHHTEEEEEEEcHHHHTTHHHH##### DISOP:02AL 1-4, 190-192| PSIPRED ccccccccEEEEEccHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHcccEEEcHHHHHHHHHHcccEEEEEEEEEEHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccEEEEcccHHHHHHHHHHHcccc //