[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glpQ
DDBJ      :glpQ         glycerophosphoryl diester phosphodiesterase
Swiss-Prot:GLPQ_BACSU   RecName: Full=Glycerophosphoryl diester phosphodiesterase;         Short=Glycerophosphodiester phosphodiesterase;         EC=3.1.4.46;

Homologs  Archaea  22/68 : Bacteria  576/915 : Eukaryota  81/199 : Viruses  2/175   --->[See Alignment]
c.1.18
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->291 2oogD PDBj 8e-78 51.7 %
:RPS:PDB   30->286 3ch0A PDBj 3e-39 24.4 %
:RPS:SCOP  36->289 1t8qA  c.1.18.3 * 1e-56 35.5 %
:HMM:SCOP  36->291 1t8qA_ c.1.18.3 * 6.3e-75 41.5 %
:RPS:PFM   43->283 PF03009 * GDPD 2e-39 44.9 %
:HMM:PFM   43->284 PF03009 * GDPD 5.1e-69 37.1 240/255  
:BLT:SWISS 1->293 GLPQ_BACSU e-162 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12007.1 GT:GENE glpQ GT:PRODUCT glycerophosphoryl diester phosphodiesterase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(233014..233895) GB:FROM 233014 GB:TO 233895 GB:DIRECTION - GB:GENE glpQ GB:PRODUCT glycerophosphoryl diester phosphodiesterase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10913081; Product type e: enzyme GB:PROTEIN_ID CAB12007.1 GB:DB_XREF GOA:P37965 InterPro:IPR017946 SubtiList:BG10646 UniProtKB/Swiss-Prot:P37965 GB:GENE:GENE glpQ LENGTH 293 SQ:AASEQ MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRGASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTLADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGMEEKLIASLQKHKLLGKHSKPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDAALEEIKTYAVGAGPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTNYPDLFHKVKKGY GT:EXON 1|1-293:0| SW:ID GLPQ_BACSU SW:DE RecName: Full=Glycerophosphoryl diester phosphodiesterase; Short=Glycerophosphodiester phosphodiesterase; EC=3.1.4.46; SW:GN Name=glpQ; Synonyms=ybeD; OrderedLocusNames=BSU02130; SW:KW Calcium; Complete proteome; Glycerol metabolism; Hydrolase;Metal-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->293|GLPQ_BACSU|e-162|100.0|293/293| GO:SWS:NREP 3 GO:SWS GO:0006071|"GO:glycerol metabolic process"|Glycerol metabolism| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| TM:NTM 1 TM:REGION 5->27| SEG 7->19|lalfvlslgllsf| BL:PDB:NREP 1 BL:PDB:REP 33->291|2oogD|8e-78|51.7|259/268| RP:PDB:NREP 1 RP:PDB:REP 30->286|3ch0A|3e-39|24.4|250/265| RP:PFM:NREP 1 RP:PFM:REP 43->283|PF03009|2e-39|44.9|225/241|GDPD| HM:PFM:NREP 1 HM:PFM:REP 43->284|PF03009|5.1e-69|37.1|240/255|GDPD| GO:PFM:NREP 2 GO:PFM GO:0006071|"GO:glycerol metabolic process"|PF03009|IPR004129| GO:PFM GO:0008889|"GO:glycerophosphodiester phosphodiesterase activity"|PF03009|IPR004129| RP:SCP:NREP 1 RP:SCP:REP 36->289|1t8qA|1e-56|35.5|251/328|c.1.18.3| HM:SCP:REP 36->291|1t8qA_|6.3e-75|41.5|253/0|c.1.18.3|1/1|PLC-like phosphodiesterases| OP:NHOMO 1295 OP:NHOMOORG 681 OP:PATTERN --1-211--------13111111----1-1-1--------------1-1-----11-111-------- -12-211111111112211-11111111111121211211-11-1721111111322---24213166541---------1-2--1--1141---------1-2112426--------------111---------11111---11311-11---------------2222------------212--1-122455555555565555453553356422242222222225634444343344443353444131133112212211322-1222211-------11111111111111-------------211---1112-3-213333333233-2--222121-1-211------1-11--111--2-3-14331-------1-2-------------------------1--112-4333231442-1--2111------122--------1111-121------------------------------1-11111111111111-233211113322222-12223--22211222213241111-----1----------1-211111111-11111-1-1----2-22-21--1--------------------1-11---22-21-122121222211111121111211-------------22231112222222222-222222222222222222233333223222222222222222232212222--344444434444---1111111111-12211-1111-1111-111111211111-2144442322311122333122222222-211222222322221112212333------1-222222---1-11121----------1--11111-111------1-----1---- ---111--21---1-1------------------------------------------------------1---------1---------1--112311-12-111---34223141---111131-32382-223----311211221-21-523122--4112-2----111--21------12331-31--1121- -------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 264 STR:RPRED 90.1 SQ:SECSTR ############################HcccccTTcEEEEETTTTTTTccTTcHHHHHHHHHHTccEEEEEEEEcTTccEEEcccccccTTTcETTEEccGcHHHHTTcccccccTTcTTcccccccccccHHHHHHHHHHHccccEEEEEEcccGGGcTTTcccHHHHHHHHHHHHTTcGGGEEEEEccHHHHHHHHHcTTcEEEEEEccTTTTcccHHHHHTTccccccEEEEcGGGGccHHHHHHHHHTTEEcccccccHHHHHHHHHHTccEEEEccGGGGHHHHHT# DISOP:02AL 1-3, 292-293| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEEEccccEEEEEccccccEEEccccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHEEcccHHHccHHHHHHHHHcccEEEEEEcccHHHHHHHHHccccEEEEccHHHHHHHHHcc //