[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : glpT
DDBJ      :glpT         glycerol-3-phosphate permease
Swiss-Prot:GLPT_BACSU   RecName: Full=Glycerol-3-phosphate transporter;         Short=G-3-P transporter;AltName: Full=G-3-P permease;

Homologs  Archaea  0/68 : Bacteria  315/915 : Eukaryota  76/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:444 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->420 1pw4A PDBj e-137 60.5 %
:RPS:PDB   81->186 2d33D PDBj 2e-04 7.5 %
:RPS:SCOP  5->431 1pw4A  f.38.1.1 * 2e-29 52.9 %
:HMM:SCOP  5->442 1pw4A_ f.38.1.1 * 3.3e-88 24.3 %
:RPS:PFM   34->367 PF07690 * MFS_1 1e-17 27.0 %
:HMM:PFM   34->399 PF07690 * MFS_1 7.4e-57 27.9 344/353  
:HMM:PFM   393->433 PF07690 * MFS_1 0.0002 24.4 41/353  
:BLT:SWISS 1->444 GLPT_BACSU 0.0 100.0 %
:PROS 153->169|PS00942|GLPT
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12008.1 GT:GENE glpT GT:PRODUCT glycerol-3-phosphate permease GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(233994..235328) GB:FROM 233994 GB:TO 235328 GB:DIRECTION - GB:GENE glpT GB:PRODUCT glycerol-3-phosphate permease GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11929549, 15849754, 16850406, 8012593; Product type t: transporter GB:PROTEIN_ID CAB12008.1 GB:DB_XREF GOA:P37948 InterPro:IPR011701 SubtiList:BG10645 UniProtKB/Swiss-Prot:P37948 GB:GENE:GENE glpT LENGTH 444 SQ:AASEQ MLNIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLRKNFAFAIPYLQEQGFSKTELGLVLAAVSIAYGFSKFIMGMVSDRCNPRYFLATGLFLSAIVNILFVSMPWVTSSVTIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIWNVAHNIGGGILAPLVTLGIAMFVTWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEEYRNDYPKHAFKNQEKELTTKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLTEAKGFSPEDSRWSYFLYEYAGIPGTILCGWISDRFFKSRRAPAGVLFMAGVFIAVLVYWLNPAGNPLVDNIALISIGFLIYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAFANAIMGFVVDRFNWNGGFIMLISSCILAIVFLALTWNTGKRAEHV GT:EXON 1|1-444:0| SW:ID GLPT_BACSU SW:DE RecName: Full=Glycerol-3-phosphate transporter; Short=G-3-P transporter;AltName: Full=G-3-P permease; SW:GN Name=glpT; Synonyms=ybeE; OrderedLocusNames=BSU02140; SW:KW Cell membrane; Complete proteome; Glycerol metabolism; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->444|GLPT_BACSU|0.0|100.0|444/444| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006071|"GO:glycerol metabolic process"|Glycerol metabolism| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 153->169|PS00942|GLPT|PDOC00726| TM:NTM 9 TM:REGION 30->52| TM:REGION 64->86| TM:REGION 102->124| TM:REGION 179->201| TM:REGION 252->274| TM:REGION 324->346| TM:REGION 351->373| TM:REGION 384->406| TM:REGION 414->435| SEG 188->208|svfffpaiiaiiisflivllv| SEG 375->392|lapkkaagtaagltgffg| BL:PDB:NREP 1 BL:PDB:REP 5->420|1pw4A|e-137|60.5|403/434| RP:PDB:NREP 1 RP:PDB:REP 81->186|2d33D|2e-04|7.5|106/499| RP:PFM:NREP 1 RP:PFM:REP 34->367|PF07690|1e-17|27.0|315/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 34->399|PF07690|7.4e-57|27.9|344/353|MFS_1| HM:PFM:REP 393->433|PF07690|0.0002|24.4|41/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 5->431|1pw4A|2e-29|52.9|414/434|f.38.1.1| HM:SCP:REP 5->442|1pw4A_|3.3e-88|24.3|437/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 894 OP:NHOMOORG 391 OP:PATTERN -------------------------------------------------------------------- 11----2-----2------------1-----------------------11---11----------2-----------------------2------------1-----1111111111111111-----------------------------------------------------------------1--2222222222222222--2212222-----1--1111-1-2433333333224331321---1----1----------1----1111111-----------------1111111111111--------------11111111212-1--21111---------1--21----3-------------1--------------1--------------------1-2-------1--------1------1-----------------------------------1111111111111---------------------1------24---------1221---------------1-------1-----------------11---11-------------------1-1-------11------------------43---1--1--1-----1--11---------------------61434414556446654-543545654557355445455533223667476877855754434335443--411111111211---------1111-----222253111111113----------1-33332121-1211-111211111111-13343333314144------------------111111---1-111---------------------------------------1- -----12-------1--------------------------------------------------------------------------------------------12-435392-1-1-121331312G1-222-11131223---213-1A222121462234-3-1444121332C233122114-42-----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 403 STR:RPRED 90.8 SQ:SECSTR ####cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHTTccTTccccHHHHHHHHHHHHHHHHTcccGGGcTTcccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccEEEEccccTTccHHHHHHHHcccEEEEEEEEccTTcTTcTHHHHHHHHHHHHHHHHHcccccTTTcccccTTTccc#############ccTHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcTTcHHHHHHHHHHHHHHHHHHTTcccTTcHHHHHHHHHHHHHHHTHHHHHHHHHHHHTccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHH######################## DISOP:02AL 7-21, 229-234, 441-444| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccHHcccc //