[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hbs
DDBJ      :hbs          non-specific DNA-binding protein HBsu; signal recognition particle-like (SRP) component
Swiss-Prot:DBH1_BACSU   RecName: Full=DNA-binding protein HU 1;AltName: Full=DNA-binding protein II;AltName: Full=HB;

Homologs  Archaea  4/68 : Bacteria  817/915 : Eukaryota  9/199 : Viruses  2/175   --->[See Alignment]
a.55.1
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->89 1hueA PDBj 1e-41 87.6 %
:RPS:PDB   1->91 3c4iB PDBj 1e-26 45.1 %
:RPS:SCOP  1->68 1b8zA  a.55.1.1 * 2e-18 38.8 %
:HMM:SCOP  1->90 1exeA_ a.55.1.1 * 2e-34 63.3 %
:RPS:PFM   1->89 PF00216 * Bac_DNA_binding 1e-22 62.9 %
:HMM:PFM   1->89 PF00216 * Bac_DNA_binding 4e-42 59.6 89/90  
:BLT:SWISS 1->92 DBH1_BACSU 7e-48 100.0 %
:PROS 46->65|PS00045|HISTONE_LIKE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14195.1 GT:GENE hbs GT:PRODUCT non-specific DNA-binding protein HBsu; signal recognition particle-like (SRP) component GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2385543..2385821) GB:FROM 2385543 GB:TO 2385821 GB:DIRECTION - GB:GENE hbs GB:PRODUCT non-specific DNA-binding protein HBsu; signal recognition particle-like (SRP) component GB:FUNCTION 16.9: Replicate 16.1: Circulate 16.3: Control 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10224127, 10231583, 10715001, 11931565, 1382620, 9106208; Product type f : factor GB:PROTEIN_ID CAB14195.1 GB:DB_XREF GOA:P08821 HSSP:1HUE InterPro:IPR000119 SubtiList:BG10276 UniProtKB/Swiss-Prot:P08821 GB:GENE:GENE hbs LENGTH 92 SQ:AASEQ MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK GT:EXON 1|1-92:0| SW:ID DBH1_BACSU SW:DE RecName: Full=DNA-binding protein HU 1;AltName: Full=DNA-binding protein II;AltName: Full=HB; SW:GN Name=hupA; Synonyms=dbpA, hbs, hbsU; OrderedLocusNames=BSU22790; SW:KW Complete proteome; Direct protein sequencing; DNA condensation;DNA-binding; Phosphoprotein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->92|DBH1_BACSU|7e-48|100.0|92/92| GO:SWS:NREP 2 GO:SWS GO:0030261|"GO:chromosome condensation"|DNA condensation| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| PROS 46->65|PS00045|HISTONE_LIKE|PDOC00044| BL:PDB:NREP 1 BL:PDB:REP 1->89|1hueA|1e-41|87.6|89/90| RP:PDB:NREP 1 RP:PDB:REP 1->91|3c4iB|1e-26|45.1|91/97| RP:PFM:NREP 1 RP:PFM:REP 1->89|PF00216|1e-22|62.9|89/90|Bac_DNA_binding| HM:PFM:NREP 1 HM:PFM:REP 1->89|PF00216|4e-42|59.6|89/90|Bac_DNA_binding| GO:PFM:NREP 1 GO:PFM GO:0003677|"GO:DNA binding"|PF00216|IPR000119| RP:SCP:NREP 1 RP:SCP:REP 1->68|1b8zA|2e-18|38.8|67/67|a.55.1.1| HM:SCP:REP 1->90|1exeA_|2e-34|63.3|90/99|a.55.1.1|1/1|IHF-like DNA-binding proteins| OP:NHOMO 2168 OP:NHOMOORG 832 OP:PATTERN ------------------------------1------------------------------111---- 342-2---------11111-11111111111111111111111151-1111-1211111112112-121211111111----1124334423-422---12222222111---------------2232222242211111---2173112211122111111111321411111111111112211111-311333333333344344221112334111111111111112-1111111111111111111111211211111111111211112311111111111111111111111-111111111111111111111211111111111111211111111-1111111111112211111112122131644333223425233343333433333333333-2242343443415557333444333334322235333336666666655335943----------111111111111111----3346433433333353343333335632333334544543365543343335353336464454333433333343845445347464566154587554B4434425411--111111-111111111-2111654541445335455555454555445444441-3434331222244444444444444244-44444444444444444444444444444444444444444444444444451444444444444--6333333333343443333333333333333333333333364555544554444445541111111113644444444445443333333333333323D-------1------1--149412---211------1--1----12111111112-2 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----111--1111--------1------ ---------------------------1--------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 91 STR:RPRED 98.9 SQ:SECSTR ccHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHTTccEEETTTEEEEEEEEccEEEEcTTTccEEEEccEEEEEEEEcHHHHHHHHT# DISOP:02AL 58-60| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEcccccccccccccEEEEccccEEEEcccHHHHHHHccc //