[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hemAT
DDBJ      :hemAT        haem-based dioxygen sensor
Swiss-Prot:HEMAT_BACSU  RecName: Full=Heme-based aerotactic transducer hemAT;

Homologs  Archaea  23/68 : Bacteria  424/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.1.1d.92.1h.4.5
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->178 1or4A PDBj 8e-93 100.0 %
:BLT:PDB   201->411 3g6bB PDBj 6e-17 31.3 %
:RPS:PDB   59->174 2bkmA PDBj 1e-08 17.7 %
:RPS:PDB   180->329 2c9eA PDBj 2e-23 6.0 %
:RPS:SCOP  10->178 1or4A  a.1.1.2 * 7e-14 100.0 %
:RPS:SCOP  200->388 3cmnA1  d.92.1.16 * 2e-19 6.9 %
:HMM:SCOP  10->178 1or4A_ a.1.1.2 * 1e-45 34.9 %
:HMM:SCOP  121->432 2ch7B1 h.4.5.1 * 2.3e-47 28.0 %
:RPS:PFM   260->411 PF00015 * MCPsignal 4e-15 34.2 %
:HMM:PFM   259->428 PF00015 * MCPsignal 1.7e-38 30.6 170/213  
:HMM:PFM   59->148 PF01152 * Bac_globin 0.00088 14.9 87/120  
:BLT:SWISS 1->432 HEMAT_BACSU 0.0 100.0 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12878.1 GT:GENE hemAT GT:PRODUCT haem-based dioxygen sensor GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1112620..1113918) GB:FROM 1112620 GB:TO 1113918 GB:DIRECTION - GB:GENE hemAT GB:PRODUCT haem-based dioxygen sensor GB:FUNCTION 16.12: Sense 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11481493, 12657801, 12962628, 15033535, 16819829, 17003124; Product type rc : receptor GB:PROTEIN_ID CAB12878.1 GB:DB_XREF GOA:O07621 InterPro:IPR012292 PDB:1OR4 SubtiList:BG13066 UniProtKB/Swiss-Prot:O07621 GB:GENE:GENE hemAT LENGTH 432 SQ:AASEQ MLFKKDRKQETAYFSDSNGQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLEAFQSEYNQTRDEQEEKKNLLHQKIQETSGSIANLFSETSRSVQELVDKSEGISQASKAGTVTSSTVEEKSIGGKKELEVQQKQMNKIDTSLVQIEKEMVKLDEIAQQIEKIFGIVTGIAEQTNLLSLNASIESARAGEHGKGFAVVANEVRKLSEDTKKTVSTVSELVNNTNTQINIVSKHIKDVNELVSESKEKMTQINRLFDEIVHSMKISKEQSGKIDVDLQAFLGGLQEVSRAVSHVAASVDSLVILTEE GT:EXON 1|1-432:0| SW:ID HEMAT_BACSU SW:DE RecName: Full=Heme-based aerotactic transducer hemAT; SW:GN Name=hemAT; Synonyms=yhfV; OrderedLocusNames=BSU10380; SW:KW 3D-structure; Complete proteome; Heme; Iron; Metal-binding;Transducer. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->432|HEMAT_BACSU|0.0|100.0|432/432| GO:SWS:NREP 3 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004871|"GO:signal transducer activity"|Transducer| GO:SWS GO:0007165|"GO:signal transduction"|Transducer| COIL:NAA 17 COIL:NSEG 2 COIL:REGION 271->279| COIL:REGION 347->354| SEG 412->427|vsravshvaasvdslv| BL:PDB:NREP 2 BL:PDB:REP 10->178|1or4A|8e-93|100.0|169/169| BL:PDB:REP 201->411|3g6bB|6e-17|31.3|201/212| RP:PDB:NREP 2 RP:PDB:REP 59->174|2bkmA|1e-08|17.7|113/128| RP:PDB:REP 180->329|2c9eA|2e-23|6.0|149/317| RP:PFM:NREP 1 RP:PFM:REP 260->411|PF00015|4e-15|34.2|152/210|MCPsignal| HM:PFM:NREP 2 HM:PFM:REP 259->428|PF00015|1.7e-38|30.6|170/213|MCPsignal| HM:PFM:REP 59->148|PF01152|0.00088|14.9|87/120|Bac_globin| GO:PFM:NREP 3 GO:PFM GO:0004871|"GO:signal transducer activity"|PF00015|IPR004089| GO:PFM GO:0007165|"GO:signal transduction"|PF00015|IPR004089| GO:PFM GO:0016020|"GO:membrane"|PF00015|IPR004089| RP:SCP:NREP 2 RP:SCP:REP 10->178|1or4A|7e-14|100.0|169/169|a.1.1.2| RP:SCP:REP 200->388|3cmnA1|2e-19|6.9|188/294|d.92.1.16| HM:SCP:REP 10->178|1or4A_|1e-45|34.9|169/169|a.1.1.2|1/1|Globin-like| HM:SCP:REP 121->432|2ch7B1|2.3e-47|28.0|268/0|h.4.5.1|1/1|Methyl-accepting chemotaxis protein (MCP) signaling domain| OP:NHOMO 2343 OP:NHOMOORG 449 OP:PATTERN ------------------------BCD8-226---3--46644-1-1A--111-2-2-13-------- -3--------------------------------------2---G---7-------------5-B-------------------5113--------------------1-------------------------1-----------33548811122------232-2243--------------1-----2E79999989CBAA999A7CCBDAA98345c77B111111GE------------------------------------------------------------------------------------------7EASgHHHGHHGEGJD-TSF---MBB--289B-II8H759C621166---34-1555-----2-8DD1-678448--------------6----411--866CA96AE635X-9-8-1-1-2233---------1222-eIb------------------------------14-13753242111138111111241212122452422-----312--313211132-3-413-------11121177C5L-21-26-1-17883467724454I62--222-1--112-1--------225---54-32437-3-1577714155551622533--11461------23B7144--------1------------------------7611423212222221222121-11------111111111111---1---------22AA2---------------111111--118433332226222231334---------51223111213223411123221221111--AdHH23663323333362--------------------------2-95643434--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 402 STR:RPRED 93.1 SQ:SECSTR #########ccccccccGGGGcccEEccGGGHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHHHHHcTTccHHHHHHHTccccHHHHTTcccccHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHTTccHTTccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHTTcGGGcccHHHHHHHHHHHHHHHHTccHHHHHHGGGTcTTHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH##################### DISOP:02AL 1-2, 5-6, 8-27, 79-88, 151-152, 154-159, 172-283, 337-338, 340-343, 348-376, 388-432| PSIPRED cccccccHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //