[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hemY
DDBJ      :hemY         protoporphyrinogen IX and coproporphyrinogen III oxidase
Swiss-Prot:PPOX_BACSU   RecName: Full=Protoporphyrinogen oxidase;         Short=PPO;         EC=1.3.3.4;

Homologs  Archaea  1/68 : Bacteria  186/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1d.16.1
:470 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->465 2ivdA PDBj 3e-42 28.1 %
:RPS:PDB   2->468 3bi2A PDBj 2e-26 12.9 %
:RPS:SCOP  7->297,416->465 2ivdA1  c.3.1.2 * 3e-69 29.7 %
:RPS:SCOP  310->415 2ivdA2  d.16.1.5 * 4e-31 25.7 %
:HMM:SCOP  1->353 1i8tA1 c.4.1.3 * 5.7e-26 21.2 %
:HMM:SCOP  307->415 1sezA2 d.16.1.5 * 4.6e-40 43.1 %
:RPS:PFM   17->409 PF01593 * Amino_oxidase 4e-10 28.5 %
:RPS:PFM   421->458 PF06518 * DUF1104 8e-04 42.1 %
:HMM:PFM   15->463 PF01593 * Amino_oxidase 1.5e-56 21.5 428/449  
:BLT:SWISS 1->470 PPOX_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12854.1 GT:GENE hemY GT:PRODUCT protoporphyrinogen IX and coproporphyrinogen III oxidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1088197..1089609 GB:FROM 1088197 GB:TO 1089609 GB:DIRECTION + GB:GENE hemY GB:PRODUCT protoporphyrinogen IX and coproporphyrinogen III oxidase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.10: Respire GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10498703, 9217019, 9784236; Product type e: enzyme GB:PROTEIN_ID CAB12854.1 GB:DB_XREF GOA:P32397 InterPro:IPR004572 SubtiList:BG10431 UniProtKB/Swiss-Prot:P32397 GB:GENE:GENE hemY LENGTH 470 SQ:AASEQ MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYIIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAPFVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS GT:EXON 1|1-470:0| SW:ID PPOX_BACSU SW:DE RecName: Full=Protoporphyrinogen oxidase; Short=PPO; EC=1.3.3.4; SW:GN Name=hemY; Synonyms=hemG; OrderedLocusNames=BSU10140; SW:KW Complete proteome; Cytoplasm; FAD; Flavoprotein; Oxidoreductase;Porphyrin biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->470|PPOX_BACSU|0.0|100.0|470/470| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006779|"GO:porphyrin biosynthetic process"|Porphyrin biosynthesis| SEG 10->15|iigggi| BL:PDB:NREP 1 BL:PDB:REP 16->465|2ivdA|3e-42|28.1|431/449| RP:PDB:NREP 1 RP:PDB:REP 2->468|3bi2A|2e-26|12.9|425/494| RP:PFM:NREP 2 RP:PFM:REP 17->409|PF01593|4e-10|28.5|351/426|Amino_oxidase| RP:PFM:REP 421->458|PF06518|8e-04|42.1|38/135|DUF1104| HM:PFM:NREP 1 HM:PFM:REP 15->463|PF01593|1.5e-56|21.5|428/449|Amino_oxidase| RP:SCP:NREP 2 RP:SCP:REP 7->297,416->465|2ivdA1|3e-69|29.7|325/341|c.3.1.2| RP:SCP:REP 310->415|2ivdA2|4e-31|25.7|105/108|d.16.1.5| HM:SCP:REP 1->353|1i8tA1|5.7e-26|21.2|297/0|c.4.1.3|1/1|Nucleotide-binding domain| HM:SCP:REP 307->415|1sezA2|4.6e-40|43.1|109/112|d.16.1.5|1/1|FAD-linked reductases, C-terminal domain| OP:NHOMO 347 OP:NHOMOORG 291 OP:PATTERN -----------------------------1-------------------------------------- 211111111111111-111-1111111111111111111111111-111111---1-1--12211112111------------11---11----11---------11-1-1111111--111111-----------11111---11-------11----------11---1------------1-111---21122222222222222211111122211121121111111111111111111111111111---------------------------------------------------------------------------------------------------------------1---------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------1---1-----------1-111111----11------------------------1--11----------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1---11-------------------------------------------------1- -1--11------11111-----1----11-----1-1111111---1---------------1----1----1-------------11----1111--1---1211-1--111111-1-1-1111112-241-11111111-111-1-1-11-11--1112-1111-111---111111I1111121-3-3211-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 470 STR:RPRED 100.0 SQ:SECSTR cccEEEEEEEEcccHHHHHHHHHHHTTcccHHTTccEEEEcccccccTTccEEEGGGcEEEccccEccTTTcHHHHHHHHHHHHccccEEccccccEEEETTTEEcccccccHHHHHTTTcHHHHHHHHHHHHHHHHTTcTTccccHHHHHHHHHHHHGGccHHHHHHHHHHGGGGHHHHTccTTTccHHHHcccTTHHHHHccccccEEETTcTHHHHHHcccccccEEEcccHHHHHHHHTcccGGGEETTccEEEEEEETTEEEEEETTccEEEEEEEEEcccHHHHGGGGccccccTTTTccEEEccEEEEEEEccccccccccEEEEcccccHHHHHHHHHcccHHEEHHHHTcccEEEEEEccTHHHHHHTTTTcHHHHHHHHHHHHHHHHTTccccEEcccccccEEEEEEEccTTTcTTHHHHTcccccEEEccTTcccTcHHHHHHHHHHHHHHHHHHHcc DISOP:02AL 1-4| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHHccccccccEEEEEEccccccEEEEEEEcccEEEEEcccEEccccHHHHHHHHHHcccccccccccccEEEEEccEEEEcccccHHHccccHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccEEEccHHHHHHHHHHHHccccEEEEcccEEEEEEcccEEEEEEcccEEEEEcEEEEEccHHHHHHHcccccHHHHHHccccccEEEEEEEEcccccccccccccEEEEccccccEEEEEEcccccccccccccEEEEEEEEcccccHHHcccHHHHHHHHHHHHHHHcccccccEEEEEEEccccEEcccccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHHHHcc //