[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hemZ
DDBJ      :hemZ         coproporphyrinogen III oxidase
Swiss-Prot:HEMZ_BACSU   RecName: Full=Oxygen-independent coproporphyrinogen-III oxidase 2;         Short=Coproporphyrinogenase;         Short=Coprogen oxidase;         EC=1.3.99.22;

Homologs  Archaea  1/68 : Bacteria  820/915 : Eukaryota  59/199 : Viruses  0/175   --->[See Alignment]
c.1.28
:501 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->165 2uv8G PDBj 3e-04 29.2 %
:BLT:PDB   171->404 1oltA PDBj 3e-14 24.1 %
:RPS:PDB   168->340 2cb6A PDBj 5e-21 12.7 %
:RPS:SCOP  168->481 1oltA  c.1.28.2 * 2e-51 22.8 %
:HMM:SCOP  145->481 1oltA_ c.1.28.2 * 1.2e-71 32.7 %
:RPS:PFM   180->340 PF04055 * Radical_SAM 3e-14 36.4 %
:HMM:PFM   178->350 PF04055 * Radical_SAM 7.8e-21 28.2 156/166  
:HMM:PFM   443->480 PF06969 * HemN_C 7.6e-05 26.5 34/118  
:BLT:SWISS 1->501 HEMZ_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB12823.2 GT:GENE hemZ GT:PRODUCT coproporphyrinogen III oxidase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1057680..1059185 GB:FROM 1057680 GB:TO 1059185 GB:DIRECTION + GB:GENE hemZ GB:PRODUCT coproporphyrinogen III oxidase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.10: Respire GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10498703; Product type e: enzyme GB:PROTEIN_ID CAB12823.2 GB:DB_XREF GOA:Q796V8 InterPro:IPR007197 SubtiList:BG12999 UniProtKB/Swiss-Prot:Q796V8 GB:GENE:GENE hemZ LENGTH 501 SQ:AASEQ MQIKIEGIHDDRLHRPLQNIANLFYEECELAYGGEEPADFVISLALSQTDEHVTVSGEVKGTGIKEQHTKFFSPDMTEKEAFKQVKNTISYVYLNLLQAHTGITQKWGILTGIRPTKLLHKKLQSGMSKEQAHAELKKDYLIHDEKIMLMQEIVDRQLAAVPDLYRVKDEVSIYIGIPFCPTKCAYCTFPAYAIQGQAGRVGSFLWGLHYEMQKIGEWLKEHDVKVTTIYFGGGTPTSITAEEMDLLYEEMVRSFPDVKNIREITVEAGRPDTITEEKLAVLNKYDIDRISINPQSYENETLKAIGRHHTVEETIEKYHLSRQHGMNNINMDLIIGLPGEGVKEFRHSLSETEKLMPESLTVHTLSFKRASEMTRNKHKYKVAGREEVSQMMEDAVAWTKEHGYVPYYLYRQKNILGNLENVGYSLPGQESIYNIMIMEEVQTIIGIGCGAASKFIDRDTGKITHFANPKDPKSYNERFEHYTDEKIKYLEQIFEKTTKQH GT:EXON 1|1-501:0| SW:ID HEMZ_BACSU SW:DE RecName: Full=Oxygen-independent coproporphyrinogen-III oxidase 2; Short=Coproporphyrinogenase; Short=Coprogen oxidase; EC=1.3.99.22; SW:GN Name=hemZ; Synonyms=yhaV, yhaW; OrderedLocusNames=BSU09840; SW:KW 4Fe-4S; Complete proteome; Iron; Iron-sulfur; Metal-binding;Oxidoreductase; Porphyrin biosynthesis; S-adenosyl-L-methionine. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->501|HEMZ_BACSU|0.0|100.0|501/501| GO:SWS:NREP 6 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006779|"GO:porphyrin biosynthetic process"|Porphyrin biosynthesis| BL:PDB:NREP 2 BL:PDB:REP 5->165|2uv8G|3e-04|29.2|144/2033| BL:PDB:REP 171->404|1oltA|3e-14|24.1|228/434| RP:PDB:NREP 1 RP:PDB:REP 168->340|2cb6A|5e-21|12.7|173/238| RP:PFM:NREP 1 RP:PFM:REP 180->340|PF04055|3e-14|36.4|143/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 178->350|PF04055|7.8e-21|28.2|156/166|Radical_SAM| HM:PFM:REP 443->480|PF06969|7.6e-05|26.5|34/118|HemN_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 168->481|1oltA|2e-51|22.8|289/436|c.1.28.2| HM:SCP:REP 145->481|1oltA_|1.2e-71|32.7|324/0|c.1.28.2|1/1|Radical SAM enzymes| OP:NHOMO 1540 OP:NHOMOORG 880 OP:PATTERN --------------------------------------------------------1----------- 111121-1111111-1111-11--1-1111111----11-11111-111111111111--1111112111211111111322-22223331111111--22222222222222222222222221222222222222221111121222222111111111112221322111111111111111111111122222222222222222222222222222211111111121211111111111111111111---11---------111-----1111111111111111111111111111111111111111111111122233333333324332223222243322222-222211111122222421-2122112112124221121332233233333332---1--21125111222433211222111133223223222222222221111222-----------111111111-1111-----1212222212222222233332223333333222222222222222223322123222122222222222111212211111111121111111112112111131112343333332322222222223222223322222222233333234333333543351-212321--11132223222333233322-3222333232333222223222332222233233223323233222222221-333233333333--12111111111222123332222111122222211211222222222222223222322211111111123333333332332222121211111111-121112222--------1-1-----------1------1---1111111222222121 ----111-----1------------------------------------------------------------------------------------------1---1-1212111---11---1-111-2--111--1-11111-1---11-11-112----111-------211-1-C111111111-11112---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 460 STR:RPRED 91.8 SQ:SECSTR ####HHHHHHHHHHHHHHH####HHTTcGGGcccccccccEEEEccTTccHHHHHHH#HHcccccHHHHHHHcTTccHHHHTHHHHTccccHHcHHHHTTcccHHHHHHHTcTTccccccHHHHTTccTTcTcGGGGTTccEEEEEcccHHHHHHHHGGGccTTcEETTcEEEEEcccHHHHHHHccccccccTTccHHHHccHHHHHHHcccccEEEEEEcEEcTTccEEcccEEGGGGccEEEEEEEcccccEEHHHHccTcTTEEEEETcccGGGEEEEETTEEEEEEEcTTcccGGGGGGccccTTccEEEccTTcTTTTccccccGGGcGGGEEccHHHHHHHHHHHHHHcEEEEEEEEcccccHHHHHHTTcccTTTTcccccHHHHHHHHHHHTTTcccccEEETTTTHEEEEccccEEEEccHHHcEEEEEcTTccEEEEEccTTcccccGcEEEcccccc################################ DISOP:02AL 496-501| PSIPRED cEEEEEEccccccccHHHHHHHHHHccccccccccccccEEEEEEEEEccccEEEEEEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHcccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHccccEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHcccccHHHHHHHHHHHccccEEEEcccEEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHccccccc //