[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hisJ
DDBJ      :hisJ         histidinol phosphate phosphatase
Swiss-Prot:HIS9_BACSU   RecName: Full=Histidinol-phosphatase;         Short=HolPase;         EC=3.1.3.15;

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  32/199 : Viruses  0/175   --->[See Alignment]
c.6.3
:268 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->267 3dcpA PDBj 1e-44 36.1 %
:RPS:PDB   3->262 3dcpA PDBj 9e-37 35.7 %
:HMM:SCOP  2->265 1m65A_ c.6.3.1 * 2.3e-33 33.0 %
:RPS:PFM   42->98 PF10255 * Paf67 8e-04 28.1 %
:HMM:PFM   5->223 PF02811 * PHP 1.2e-16 22.0 159/175  
:BLT:SWISS 1->268 HIS9_BACSU e-158 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14940.1 GT:GENE hisJ GT:PRODUCT histidinol phosphate phosphatase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 3031614..3032420 GB:FROM 3031614 GB:TO 3032420 GB:DIRECTION + GB:GENE hisJ GB:PRODUCT histidinol phosphate phosphatase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10322033; Product type e: enzyme GB:PROTEIN_ID CAB14940.1 GB:DB_XREF GOA:O34411 InterPro:IPR004013 SubtiList:BG13931 UniProtKB/Swiss-Prot:O34411 GB:GENE:GENE hisJ LENGTH 268 SQ:AASEQ MQKRDGHIHTPFCPHGSNDTLRQYAEEALKKGFESITFTEHAPLPPSFTDPTPLKDSAMAQASLERYIHEISGLKKEYRGQLSIRTGLEVDYIAEFEDEITLFLDTYGPYLDDSILSVHFLRTDSSYLCLDYDEHTFKELISACGSIEAVYEQYYRSIYSSIVASLGVYKPKRVGHITLVQKFIKLFPYSMSEHIRGLVSLCLNAIEENGMELDFNTSGLRKTYAGGIYIEDWMLNEAKQKKIPLVFGSDAHQAGDVGYAYEAFLERC GT:EXON 1|1-268:0| SW:ID HIS9_BACSU SW:DE RecName: Full=Histidinol-phosphatase; Short=HolPase; EC=3.1.3.15; SW:GN Name=hisK; Synonyms=hisJ; OrderedLocusNames=BSU29620; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->268|HIS9_BACSU|e-158|100.0|268/268| GO:SWS:NREP 3 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| BL:PDB:NREP 1 BL:PDB:REP 3->267|3dcpA|1e-44|36.1|263/269| RP:PDB:NREP 1 RP:PDB:REP 3->262|3dcpA|9e-37|35.7|258/269| RP:PFM:NREP 1 RP:PFM:REP 42->98|PF10255|8e-04|28.1|57/400|Paf67| HM:PFM:NREP 1 HM:PFM:REP 5->223|PF02811|1.2e-16|22.0|159/175|PHP| HM:SCP:REP 2->265|1m65A_|2.3e-33|33.0|206/0|c.6.3.1|1/1|PHP domain-like| OP:NHOMO 124 OP:NHOMOORG 115 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------111--1---------------------------------------------------1-------------------------------------11111----11---------------211111---1111111111111-2---------------------------1---11-------11-111------------------------------------------------1-----------1---222-----1-111111111-12-111---1----------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------11-2-111-----1-----------------11-11-------1-------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------1----------------------------------------------------1-1 ------1-------1-1111------1---------1121-11---11--111-11---111------------------------11-1--1111----1----------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 98.9 SQ:SECSTR ##cEEEEEccTTcTTccccccHHHHHHHHHTTccEEEEEEEccccHHHHTccccTHHHHTTccGGHHHHHHHHHHHHTTTTcEEEEEEEEEccTTcHHHHHHHHHHHGGGccEEEEEccEEEETTEEEEccccHHHHHHHTHHHTcHHHHHHHHHHHHHHHHHccccTTccccEccTTGGGTTGGGGTccGGGccHHHHHHHHHHHHHHTcEEEEEcGGGGcTTcccccccHHHHHHHHHTTccEEEEcccccGGGTTTTHHGcEEc# PSIPRED ccccccccccccccccccccHHHHHHHHHHccccEEEEEcccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHHHHcccccEEEEEEEEEccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHcccccccHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHcc //