[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : hisS
DDBJ      :hisS         histidyl-tRNA synthetase
Swiss-Prot:SYH_BACSU    RecName: Full=Histidyl-tRNA synthetase;         EC=6.1.1.21;AltName: Full=Histidine--tRNA ligase;         Short=HisRS;

Homologs  Archaea  68/68 : Bacteria  891/915 : Eukaryota  161/199 : Viruses  0/175   --->[See Alignment]
c.51.1d.104.1
:424 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->419 1qe0A PDBj e-119 57.1 %
:RPS:PDB   5->420 1adjA PDBj 1e-60 42.0 %
:RPS:SCOP  19->313 1usyA  d.104.1.1 * 8e-60 20.4 %
:RPS:SCOP  330->420 1wu7A1  c.51.1.1 * 1e-22 25.3 %
:HMM:SCOP  2->317 1kmmA2 d.104.1.1 * 1.8e-95 40.1 %
:HMM:SCOP  327->420 1adjA1 c.51.1.1 * 1.5e-24 45.2 %
:RPS:PFM   23->169 PF00587 * tRNA-synt_2b 9e-18 39.6 %
:RPS:PFM   334->419 PF03129 * HGTP_anticodon 6e-12 37.2 %
:HMM:PFM   20->179 PF00587 * tRNA-synt_2b 8.1e-36 25.3 158/173  
:HMM:PFM   331->420 PF03129 * HGTP_anticodon 3.2e-22 34.4 90/94  
:BLT:SWISS 1->424 SYH_BACSU 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14715.1 GT:GENE hisS GT:PRODUCT histidyl-tRNA synthetase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2816535..2817809) GB:FROM 2816535 GB:TO 2817809 GB:DIRECTION - GB:GENE hisS GB:PRODUCT histidyl-tRNA synthetase GB:FUNCTION 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; Product type e: enzyme GB:PROTEIN_ID CAB14715.1 GB:DB_XREF GOA:O32039 HSSP:1QE0 InterPro:IPR004516 SubtiList:BG12605 UniProtKB/Swiss-Prot:O32039 GB:GENE:GENE hisS LENGTH 424 SQ:AASEQ MGYNIPRGTQDILPGESDRWQFVEQIMRDTCRTYQYKEIRTPIFEHTELFARGVGESTDIVQKEMYTFEDRKGRSLTLRPEGTAAAVRAFNENKLFANPVQPTKLYYVGPMFRYERPQTGRYRQFYQFGIEAIGSKDPAIDAEVMALAMSIYEKAGLENVKLVINSLGDQDSRKSYREALVKHFEPRIEEFCSDCQSRLHTNPLRILDCKKDRDHELMKSAPSILTYLNEESAAYFEKVKQYLNDLGISYEIDPNLVRGLDYYNHTAFEIMSNAEGFGAITTLAGGGRYDGLVEQIGGPEAPGIGFAMSIERLLAAIDAEKRELPVDKGIDCYIVTLGEKAKDYSVSLVYKLREAGISSEIDYENKKMKGQFKTADRLKARFIAILGEDELAQNKINVKDAQTGEQIEVALDEFIHVMKANQKG GT:EXON 1|1-424:0| SW:ID SYH_BACSU SW:DE RecName: Full=Histidyl-tRNA synthetase; EC=6.1.1.21;AltName: Full=Histidine--tRNA ligase; Short=HisRS; SW:GN Name=hisS; OrderedLocusNames=BSU27560; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->424|SYH_BACSU|0.0|100.0|424/424| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 5->419|1qe0A|e-119|57.1|385/390| RP:PDB:NREP 1 RP:PDB:REP 5->420|1adjA|1e-60|42.0|412/420| RP:PFM:NREP 2 RP:PFM:REP 23->169|PF00587|9e-18|39.6|144/170|tRNA-synt_2b| RP:PFM:REP 334->419|PF03129|6e-12|37.2|86/91|HGTP_anticodon| HM:PFM:NREP 2 HM:PFM:REP 20->179|PF00587|8.1e-36|25.3|158/173|tRNA-synt_2b| HM:PFM:REP 331->420|PF03129|3.2e-22|34.4|90/94|HGTP_anticodon| GO:PFM:NREP 9 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF03129|IPR004154| GO:PFM GO:0005524|"GO:ATP binding"|PF03129|IPR004154| GO:PFM GO:0006412|"GO:translation"|PF03129|IPR004154| RP:SCP:NREP 2 RP:SCP:REP 19->313|1usyA|8e-60|20.4|260/275|d.104.1.1| RP:SCP:REP 330->420|1wu7A1|1e-22|25.3|91/97|c.51.1.1| HM:SCP:REP 2->317|1kmmA2|1.8e-95|40.1|312/322|d.104.1.1|1/1|Class II aaRS and biotin synthetases| HM:SCP:REP 327->420|1adjA1|1.5e-24|45.2|93/96|c.51.1.1|1/1|Class II aaRS ABD-related| OP:NHOMO 1437 OP:NHOMOORG 1120 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-111111111111111111111---1-1-11--111-1111---11111111-111---1112211221111111111--1111111111111111111111111111111111111222222222222222212211111111121122121211111211111111112112233333333133333332221233322221112222223311111111111111111111111111111111122111111212221111111211111111111111111111111111211112111123123111221212221222111212112122122221222222221111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111-111111111211111111211111111111112211112222222221211121211211111111121111111111111111112222222221111111111-111112111111111111111111111121111111111111111111111111111121111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111311111111111111111111111111111111112111111111111111111112111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 -111221-2111-111-111111111111-111----------11111111111111211111111111-1-11-11-11--111-11-121--1----111-2-212222-112132221-3122112CS2-26C121122222-21212223121431331111-22-312111-22P2222222422222223222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 424 STR:RPRED 100.0 SQ:SECSTR HcGcccTTcccccHHHHHHHHHHHHHHHHHHHHTTcEEcccccEEEHHHHHHHHcTTcHHHHHcccEEEcTTccEEEEccccHHHHHHHHHHTTGGGcccccEEEEEEEEEEcccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHHTTccccEEEEEEcccHHHHHHHHHHHHHHHGGGGGGccHHHHHHTTccGGGGTTcccHHHHHHHHHcccGGGGccHHHHHHHHHHHHHHHHTTccEEEcccccccccccccEEEEEEccccccccEEEEEEEEEcTTHHHHTTcccccEEEEEEEHHHHHHHHHHTTccccccccccEEEEEccHHHHHHHHHHHHHHHTTTccEEEccccccHHHHHHHHHHTTccEEEEEcHHHHHHTEEEEEETTTccEEEEETTHHHHHHHHccTc DISOP:02AL 423-424| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHccccccHHHccccEEEEEccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEccccccccccEEEEEccEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEccHHHcccccccccEEEEEEcccccccccEEEEccccHHHHHHHccccccEEEEEccHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcHHHHHccEEEEEEcccccEEEEcHHHHHHHHHHHccc //