[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : htrA
DDBJ      :htrA         membrane bound serine protease Do, quality control protease (heat-shock protein)
Swiss-Prot:HTRA_BACSU   RecName: Full=Probable serine protease do-like htrA;         EC=3.4.21.-;

Homologs  Archaea  29/68 : Bacteria  873/915 : Eukaryota  93/199 : Viruses  0/175   --->[See Alignment]
b.36.1b.47.1
:449 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   171->441 2zleA PDBj 2e-45 44.7 %
:RPS:PDB   173->325 3ee1A PDBj 2e-37 14.1 %
:RPS:PDB   315->436 2cssA PDBj 4e-17 24.1 %
:RPS:SCOP  170->322 2bhgA1  b.47.1.4 * 3e-33 25.2 %
:RPS:SCOP  313->434 1nf3C  b.36.1.1 * 3e-15 12.3 %
:HMM:SCOP  91->352 1qtfA_ b.47.1.1 * 1.4e-60 42.9 %
:HMM:SCOP  341->445 1lcyA1 b.36.1.4 * 3.5e-22 37.0 %
:RPS:PFM   173->306 PF00089 * Trypsin 2e-06 38.8 %
:RPS:PFM   371->429 PF00595 * PDZ 7e-05 43.1 %
:HMM:PFM   171->328 PF00089 * Trypsin 4.1e-20 25.9 158/219  
:HMM:PFM   367->419 PF00595 * PDZ 1.1e-08 28.3 53/81  
:BLT:SWISS 1->449 HTRA_BACSU 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13147.2 GT:GENE htrA GT:PRODUCT membrane bound serine protease Do, quality control protease (heat-shock protein) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(1357936..1359285) GB:FROM 1357936 GB:TO 1359285 GB:DIRECTION - GB:GENE htrA GB:PRODUCT membrane bound serine protease Do, quality control protease (heat-shock protein) GB:FUNCTION 16.3: Control 16.6: Maintain GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 10692364, 11133960, 11555295, 12823817; Product type e: enzyme GB:PROTEIN_ID CAB13147.2 GB:DB_XREF GOA:O34358 HSSP:1LCY InterPro:IPR001940 SubtiList:BG12608 UniProtKB/Swiss-Prot:O34358 GB:GENE:GENE htrA LENGTH 449 SQ:AASEQ MDNYRDENRTKGNENEVFLTKENDQSASYSARNVIHDQEKKKRGFGWFRPLLGGVIGGSLALGIYTFTPLGDHDSQDTAKQSSSQQQTQSVTATSTSSESKKSSSSSSAFKSEDSSKISDMVEDLSPAIVGITNLQAQSNSSLFGSSSSDSSEDTESGSGSGVIFKKENGKAYIITNNHVVEGASSLKVSLYDGTEVTAKLVGSDSLTDLAVLQISDDHVTKVANFGDSSDLRTGETVIAIGDPLGKDLSRTVTQGIVSGVDRTVSMSTSAGETSINVIQTDAAINPGNSGGPLLNTDGKIVGINSMKISEDDVEGIGFAIPSNDVKPIAEELLSKGQIERPYIGVSMLDLEQVPQNYQEGTLGLFGSQLNKGVYIREVASGSPAEKAGLKAEDIIIGLKGKEIDTGSELRNILYKDAKIGDTVEVKILRNGKEMTKKIKLDQKEEKTS GT:EXON 1|1-449:0| SW:ID HTRA_BACSU SW:DE RecName: Full=Probable serine protease do-like htrA; EC=3.4.21.-; SW:GN Name=htrA; OrderedLocusNames=BSU12900; SW:KW Cell membrane; Complete proteome; Hydrolase; Membrane; Protease;Serine protease; Stress response; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->449|HTRA_BACSU|0.0|100.0|449/449| GO:SWS:NREP 7 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| GO:SWS GO:0006950|"GO:response to stress"|Stress response| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| SEG 74->119|dsqdtakqsssqqqtqsvtatstsseskkssssssafksedsskis| SEG 139->162|snsslfgssssdssedtesgsgsg| BL:PDB:NREP 1 BL:PDB:REP 171->441|2zleA|2e-45|44.7|237/396| RP:PDB:NREP 2 RP:PDB:REP 173->325|3ee1A|2e-37|14.1|128/336| RP:PDB:REP 315->436|2cssA|4e-17|24.1|112/121| RP:PFM:NREP 2 RP:PFM:REP 173->306|PF00089|2e-06|38.8|134/217|Trypsin| RP:PFM:REP 371->429|PF00595|7e-05|43.1|58/82|PDZ| HM:PFM:NREP 2 HM:PFM:REP 171->328|PF00089|4.1e-20|25.9|158/219|Trypsin| HM:PFM:REP 367->419|PF00595|1.1e-08|28.3|53/81|PDZ| GO:PFM:NREP 3 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00089|IPR001254| GO:PFM GO:0006508|"GO:proteolysis"|PF00089|IPR001254| GO:PFM GO:0005515|"GO:protein binding"|PF00595|IPR001478| RP:SCP:NREP 2 RP:SCP:REP 170->322|2bhgA1|3e-33|25.2|139/194|b.47.1.4| RP:SCP:REP 313->434|1nf3C|3e-15|12.3|114/123|b.36.1.1| HM:SCP:REP 91->352|1qtfA_|1.4e-60|42.9|219/0|b.47.1.1|1/1|Trypsin-like serine proteases| HM:SCP:REP 341->445|1lcyA1|3.5e-22|37.0|100/100|b.36.1.4|1/1|PDZ domain-like| OP:NHOMO 2584 OP:NHOMOORG 995 OP:PATTERN --1----1111111111111111-111112-1--1-----------1-----------------1-13 2372611211111133333-32333333333334442353244433113221445211113421325344211111111111512222112111111--1111123212211111111111111111111111131333554444463473342233333433233554773322223322237532222-423222222222222222223333223123322211111136222222222222222222221111111111111111111122211111111111111111111111111111111111111111111111211311111111111423322223231132221222221223322221-2229344733333648785436455433333333333-67566554373163337867663443333312444322333333333233348331111111111111111211211111111122122122222444544334445545444444554444322543533423444422352422221111111223363231121232432221232342242554586351111111111111111111121121332222233222222222222222222222221-1323411-11133332333333333333-3333333333333333333333332223333333333333333333332333133333333333311321111122224342212222222221222222222222223422222222222222222---------12222222222222222222222222222--4133333311121222431-------------111---------1111111111454 11--112-1---111---------------------------------------------------------------------------------------------C-25544d24313454752749J4-4391323554331322242164544311111--11121--215865*554779AAB-BA3621118 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 62.6 SQ:SECSTR ########################################################################################################################################################################EcHHHHHHHHHHHTTcHHHHHHHHHTTcTTTTcccHHHHHHHHHHHHHHHEEEcEHHHHHccccccEEEEEEEEccccEETTcEEEEEEccEEEccEEccTTcccEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHccGccGGcEEEEEEEEccccTTcccEEEEcTTccEEEEccEHHHHHHcccccccEEEHHHHTTccccEEccEEETTEEEEEEEcTTccEEEEcccccccGGGTTccccHcccTTccccEEEEETTEEEEEEEEEccTTcccc PSIPRED cccHHHHHHccccccEEEEEEccccccccccccccccccccccccccEEEEHHHHHHHHHEEEEEEEEccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHcccEEEEEEEEEEccccccccccccccccccEEEEEEEEEEccccEEEEEEEHHHcccccEEEEEEccccEEEEEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEccccccccccEEEEEEEccccccccccccccccEEEEEEEEEEcccccccEEEcccccEEEEEEEEEccccccccEEEEEHHHHHHHHHHHEEcccccccccccEEccccccHHHHHHHHHHHcccccccEEEEEEEccccHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccccEEEEEEEEccEEEEEEEEEEEcccccc //