[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : iolB
DDBJ      :iolB         5-deoxy-D-glucuronic acid isomerase
Swiss-Prot:IOLB_BACSU   RecName: Full=5-deoxy-glucuronate isomerase;         Short=5DG isomerase;         EC=5.3.1.n1;

Homologs  Archaea  0/68 : Bacteria  175/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->268 2qjvA PDBj 2e-47 48.5 %
:RPS:PDB   138->267 2d5hC PDBj 3e-04 9.0 %
:RPS:SCOP  53->252 1x8mA  b.82.1.13 * 2e-36 23.3 %
:HMM:SCOP  2->257 1x8mA_ b.82.1.13 * 5.6e-70 45.1 %
:RPS:PFM   19->267 PF04962 * KduI 8e-57 44.1 %
:HMM:PFM   12->268 PF04962 * KduI 7.2e-111 55.1 256/262  
:BLT:SWISS 1->271 IOLB_BACSU e-161 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16011.2 GT:GENE iolB GT:PRODUCT 5-deoxy-D-glucuronic acid isomerase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4082030..4082845) GB:FROM 4082030 GB:TO 4082845 GB:DIRECTION - GB:GENE iolB GB:PRODUCT 5-deoxy-D-glucuronic acid isomerase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11566986, 12112707, 18310071, 9887260; Product type e: enzyme GB:PROTEIN_ID CAB16011.2 GB:DB_XREF GOA:P42413 InterPro:IPR010669 SubtiList:BG11118 UniProtKB/Swiss-Prot:P42413 GB:GENE:GENE iolB LENGTH 271 SQ:AASEQ MSYLLRKPQSHEVSNGVKLVHEVTTSNSDLTYVEFKVLDLASGSSYTEELKKQEICIVAVTGKITVTDHESTFENIGTRESVFERKPTDSVYISNDRAFEITAVSDARVALCYSPSEKQLPTKLIKAEDNGIEHRGQFSNKRTVHNILPDSDPSANSLLVVEVYTDSGNWSSYPPHKHDQDNLPEESFLEETYYHELDPGQGFVFQRVYTDDRSIDETMTVGNENVVIVPAGYHPVGVPDGYTSYYLNVMAGPTRKWKFYNDPAHEWILER GT:EXON 1|1-271:0| SW:ID IOLB_BACSU SW:DE RecName: Full=5-deoxy-glucuronate isomerase; Short=5DG isomerase; EC=5.3.1.n1; SW:GN Name=iolB; Synonyms=yxdB; OrderedLocusNames=BSU39750; ORFNames=E83B; SW:KW Complete proteome; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->271|IOLB_BACSU|e-161|100.0|271/271| GO:SWS:NREP 1 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 20->268|2qjvA|2e-47|48.5|237/252| RP:PDB:NREP 1 RP:PDB:REP 138->267|2d5hC|3e-04|9.0|122/369| RP:PFM:NREP 1 RP:PFM:REP 19->267|PF04962|8e-57|44.1|247/258|KduI| HM:PFM:NREP 1 HM:PFM:REP 12->268|PF04962|7.2e-111|55.1|256/262|KduI| GO:PFM:NREP 2 GO:PFM GO:0008697|"GO:4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase activity"|PF04962|IPR007045| GO:PFM GO:0045490|"GO:pectin catabolic process"|PF04962|IPR007045| RP:SCP:NREP 1 RP:SCP:REP 53->252|1x8mA|2e-36|23.3|172/259|b.82.1.13| HM:SCP:REP 2->257|1x8mA_|5.6e-70|45.1|233/267|b.82.1.13|1/1|RmlC-like cupins| OP:NHOMO 185 OP:NHOMOORG 175 OP:PATTERN -------------------------------------------------------------------- --2-1---111----------1---1------1----1111---11---1--111--1-----11-1211------------1------------------------1-------------------------------11-----------------------------------------------11-1-111111--2-1-1---1111-111--11----11111--1-------------------------1---------11-----------------------------------------------------------------1-1-----11--1----1------------------------11-------------------11111111-11------1--11--111111121111---1-2211-1221---------111---------------------------------------------111111111111121111111111--------11----1----1-----------------------------1----------------------------------------------------------------------------------------------1--11-1-----------------1------------1111111-1--------1--1---1---------111111111111---------------1-1----1------111-----------1------1-1------111-------------2-----------------------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 245 STR:RPRED 90.4 SQ:SECSTR ###################EEEEcHHHHTccccEEEEEEEc#TcEEEEccccEEEEEEEEEcEEEEET#TEEEEEEccc#cGGGcccccEEEEccccc#EEEEcccEEEEEEEEEcccccccEEEcGGGcEEEEEcGEEcccEEEEEccTTcHHHHHHTccEEEEEEcTTcEEEEEEccccETTTEEEcEEEEEEEcccEEEEcccccccccccccccccccTTEEEEEcTTcEEEEccccccEEEEEEEcTTcTTcccccccccEEG### DISOP:02AL 271-272| PSIPRED cccccccccccccccccEEEEEEcccccccEEccEEEEEEccccEEEEEccccEEEEEEcccEEEEEEccEEEHHcccccccccccccEEEEEccccEEEEEEccccEEEEEEcccccccccEEEcHHHcccEEEcccccEEEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccEEEEEEEcccccEEEEEEccccccccEEEEEEcccEEEcccccccEEccccccEEEEEEEEccccEEEEEEcHHHHHHHcc //