[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : iolJ
DDBJ      :iolJ         2-deoxy-5-keto-D-gluconic acid 6-phosphate aldolase
Swiss-Prot:IOLJ_BACSU   RecName: Full=6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase;         Short=DKGP aldolase;         EC=4.1.2.29;

Homologs  Archaea  2/68 : Bacteria  650/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:290 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->284 1rv8A PDBj 5e-54 44.0 %
:RPS:PDB   4->283 3c56A PDBj 2e-43 36.2 %
:RPS:SCOP  2->284 1gvfA  c.1.10.2 * 6e-93 37.1 %
:HMM:SCOP  2->285 1gvfA_ c.1.10.2 * 4.5e-100 49.1 %
:RPS:PFM   2->283 PF01116 * F_bP_aldolase 8e-66 49.8 %
:HMM:PFM   3->284 PF01116 * F_bP_aldolase 1.2e-102 48.0 279/286  
:BLT:SWISS 1->290 IOLJ_BACSU e-165 100.0 %
:PROS 74->87|PS00602|ALDOLASE_CLASS_II_1
:PROS 134->145|PS00806|ALDOLASE_CLASS_II_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16003.1 GT:GENE iolJ GT:PRODUCT 2-deoxy-5-keto-D-gluconic acid 6-phosphate aldolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4073081..4073953) GB:FROM 4073081 GB:TO 4073953 GB:DIRECTION - GB:GENE iolJ GB:PRODUCT 2-deoxy-5-keto-D-gluconic acid 6-phosphate aldolase GB:FUNCTION 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 10658656, 11325924, 18310071, 9226270; Product type e: enzyme GB:PROTEIN_ID CAB16003.1 GB:DB_XREF GOA:P42420 HSSP:1GVF InterPro:IPR000771 SubtiList:BG11125 UniProtKB/Swiss-Prot:P42420 GB:GENE:GENE iolJ LENGTH 290 SQ:AASEQ MAFVSMKELLEDAKREQYAIGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGFKTIAAMVGALIEDMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGSHQPIDENIAMTKEVTDYAAKHGVSVEAEVGTVGGMEDGLVGGVRYADITECERIVKETNIDALAAALGSVHGKYQGEPNLGFKEMEAISRMTDIPLVLHGASGIPQDQIKKAITLGHAKININTECMVAWTDETRRMFQENSDLYEPRGYLTPGIEAVEETVRSKMREFGSAGKAAKQQVG GT:EXON 1|1-290:0| SW:ID IOLJ_BACSU SW:DE RecName: Full=6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase; Short=DKGP aldolase; EC=4.1.2.29; SW:GN Name=iolJ; Synonyms=fbaB, yxdI; OrderedLocusNames=BSU39670;ORFNames=B65C; SW:KW Complete proteome; Lyase; Metal-binding; Phosphoprotein; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->290|IOLJ_BACSU|e-165|100.0|290/290| GO:SWS:NREP 2 GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 74->87|PS00602|ALDOLASE_CLASS_II_1|PDOC00523| PROS 134->145|PS00806|ALDOLASE_CLASS_II_2|PDOC00523| BL:PDB:NREP 1 BL:PDB:REP 8->284|1rv8A|5e-54|44.0|268/297| RP:PDB:NREP 1 RP:PDB:REP 4->283|3c56A|2e-43|36.2|271/297| RP:PFM:NREP 1 RP:PFM:REP 2->283|PF01116|8e-66|49.8|279/285|F_bP_aldolase| HM:PFM:NREP 1 HM:PFM:REP 3->284|PF01116|1.2e-102|48.0|279/286|F_bP_aldolase| GO:PFM:NREP 3 GO:PFM GO:0004332|"GO:fructose-bisphosphate aldolase activity"|PF01116|IPR000771| GO:PFM GO:0006096|"GO:glycolysis"|PF01116|IPR000771| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01116|IPR000771| RP:SCP:NREP 1 RP:SCP:REP 2->284|1gvfA|6e-93|37.1|272/273|c.1.10.2| HM:SCP:REP 2->285|1gvfA_|4.5e-100|49.1|281/0|c.1.10.2|1/1|Aldolase| OP:NHOMO 1225 OP:NHOMOORG 756 OP:PATTERN ----------------------------11-------------------------------------- -11-1--------------------2-------------1----11-----1423--2-------12222-11111112-1--1----111111----111----113-1---------------111111111-1----------1112111111111111111121111111-111-1-1-11111111-122222212412121117233222211222112444444211111111111111111111111-1381-111111177111---11111121111121111111111111111111111111111111111311222222222323141123321211121111221111211221121-1--11111------122421-1111111111111111-11111111-1--1-----211-22-1---111222211---------1--1-111-----------------------------------111111111111111111111111111122133111112211112112111211-1111111111111112-11--2111-11111---1---11-----1---1-11------11111111111111221-1-1211-3111111111111111111111-1111111-11131112314668487844-64347664846853444434343322232333333334232344333333211133333323333111111111----21111-------------11111111111-111111112111111111111111111111124-----11-11--------------1112---------------1111111-1-21111222121121111111111211111- -----------1--121233222535222-111222122212222211122154112113221-1111111111111-1111111----112122222221-1224--4---------------------------------------------------------------------1I111--11212112322-12 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 99.3 SQ:SECSTR #ccccHHHHHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEHHHHHHHcHHHHHHHHHHHHHHHccTTccEEEEEEEEccHHHHHHHHHHTccEEEEccTTccHHHHHHHHHHHHHHHHHTTcEEEEEEccccccccccEEEcccccHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHHHHHHcccEEccccccccHHHHHHHHHHTEEEEEEcHHHHHHHHHHHHHHHHHcTTcccHHHHHHHHHHHHHHHHHHHHHHHTcTTccTcccc# PSIPRED cccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEcHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHccccEEEEEcHHccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHcccccEEEEccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcc //