[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : iolR
DDBJ      :iolR         transcriptional regulator (DeoR family)
Swiss-Prot:IOLR_BACSU   RecName: Full=HTH-type transcriptional regulator iolR;

Homologs  Archaea  1/68 : Bacteria  547/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:251 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->65 1aoyA PDBj 3e-07 13.8 %
:RPS:PDB   38->239 3dlxB PDBj 3e-27 12.4 %
:RPS:SCOP  5->54 1lvaA4  a.4.5.35 * 2e-09 18.0 %
:RPS:SCOP  55->241 1t5oA  c.124.1.5 * 2e-24 12.2 %
:HMM:SCOP  1->80 1stzA1 a.4.5.51 * 8.7e-12 28.8 %
:HMM:SCOP  71->234 1lk5A1 c.124.1.4 * 9.9e-34 27.1 %
:RPS:PFM   5->54 PF08220 * HTH_DeoR 1e-08 42.0 %
:RPS:PFM   75->229 PF00455 * DeoR 2e-23 37.4 %
:HMM:PFM   75->229 PF00455 * DeoR 2.7e-57 46.5 155/157  
:HMM:PFM   5->61 PF08220 * HTH_DeoR 9e-25 38.6 57/57  
:BLT:SWISS 1->251 IOLR_BACSU e-136 100.0 %
:PROS 5->39|PS00894|HTH_DEOR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16013.1 GT:GENE iolR GT:PRODUCT transcriptional regulator (DeoR family) GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 4084799..4085554 GB:FROM 4084799 GB:TO 4085554 GB:DIRECTION + GB:GENE iolR GB:PRODUCT transcriptional regulator (DeoR family) GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 11566986, 11807058, 9887260; Product type r: regulator GB:PROTEIN_ID CAB16013.1 GB:DB_XREF GOA:P46337 InterPro:IPR018356 SubtiList:BG11364 UniProtKB/Swiss-Prot:P46337 GB:GENE:GENE iolR LENGTH 251 SQ:AASEQ MKLMRIQEMEEYILSHGTVSLDELCQVFNVSKNTVRRDINKLTEKGAIEKVYGGVTSIEKTALVPFENRTIQHQDEKTKIAHYASRFIEDHDLVFIDSGTTTKSILDTLDPAKNVTILTNSLDIINAASALKNINLIIIGNNYKRKTRSFVGMDDPAMLDKYNINKAFMSATGTTLTHGLTNSDLLEYEIKKRISEKAKEVYLLADHSKFGKSTLLTYAPFDRLHCIVTSQPLDDEYTQYCNEHQIGIHLA GT:EXON 1|1-251:0| SW:ID IOLR_BACSU SW:DE RecName: Full=HTH-type transcriptional regulator iolR; SW:GN Name=iolR; OrderedLocusNames=BSU39770; ORFNames=SS92FR; SW:KW Complete proteome; DNA-binding; Repressor; Transcription;Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->251|IOLR_BACSU|e-136|100.0|251/251| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 5->39|PS00894|HTH_DEOR_1|PDOC00696| SEG 133->142|ninliiignn| RP:PDB:NREP 2 RP:PDB:REP 1->65|1aoyA|3e-07|13.8|65/78| RP:PDB:REP 38->239|3dlxB|3e-27|12.4|201/465| RP:PFM:NREP 2 RP:PFM:REP 5->54|PF08220|1e-08|42.0|50/56|HTH_DeoR| RP:PFM:REP 75->229|PF00455|2e-23|37.4|155/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 75->229|PF00455|2.7e-57|46.5|155/157|DeoR| HM:PFM:REP 5->61|PF08220|9e-25|38.6|57/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 5->54|1lvaA4|2e-09|18.0|50/60|a.4.5.35| RP:SCP:REP 55->241|1t5oA|2e-24|12.2|181/340|c.124.1.5| HM:SCP:REP 1->80|1stzA1|8.7e-12|28.8|80/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 71->234|1lk5A1|9.9e-34|27.1|144/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 2110 OP:NHOMOORG 552 OP:PATTERN ------------------------2------------------------------------------- 33--8112334111-------3---5------322212221--1611-11226351-4--1136547443311111112---1--------1--------12--14-6-9--------------------------22211----------------------------1-------------32---22-31422222323232233275442433411113236666665A2222222222222224322332-1361-32255--771411--3433343333444444444444444444444444444533221333551178332334363413--24422212-2121----1--1--42226222--12--------1-113---1311144444444445---1--1121A--7665455986652----3225245322111111113222---2-------------------------------1---111113444432333344773332124262232--1211-1111-1323-------411111111----1---2---12--1---1-------11-----1-----------------------------5392-1111233111111122211111111-------------8576663BA9DBDDDBB-ACBBABCBBCAEBABBCB6EDE56433DAEDEDEDDCDDCDDDAA98CCB93-766666556666---------------136444747223225885----------3133232533222222455----------333744444433692111111----------3-------------------------1-1-------1-------41--12111-11 -------------2------------------------------------------------------------------------------------------------------------------------------------------------1----1------4---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 100.0 SQ:SECSTR TTHHHHHHHHHHHHHGGGccccHHHHTHHHHHHHHHHcTTcccGGGccccGGGccEEEEcccccccccccccccHHHHHHHHHHGGGccTTEEEEEcTTHHHHHHGGGccTTccEEEEETTTEEEEcccccTcccTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEEcccccccTTHHHHTccTTcEEEEEGEEcEEccccccccccccccEEEcccEEEEEETTEEcTTEccTTHH DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHcccEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccEEEcccccccHHHHHHHccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHccccEEEEEccHHHHHHHHcccccEEEEEccEEEccccEEEcHHHHHHHHHccccEEEEEEcEEccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccccccEEEEcccccHHHHHHHHHcccEEEEc //