[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : jag
DDBJ      :jag          SpoIIIJ-associated RNA/ssDNA-binding protein
Swiss-Prot:JAG_BACSU    RecName: Full=Protein jag;AltName: Full=SpoIIIJ-associated protein;

Homologs  Archaea  0/68 : Bacteria  253/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.7
:208 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   19->208 3gkuA PDBj 7e-29 41.8 %
:RPS:PDB   74->117 2cpqA PDBj 2e-04 13.6 %
:RPS:PDB   135->208 2cpmA PDBj 3e-14 19.7 %
:RPS:SCOP  146->207 1mszA  d.68.7.1 * 3e-09 20.3 %
:HMM:SCOP  145->208 1mszA_ d.68.7.1 * 3.6e-09 31.1 %
:RPS:PFM   149->205 PF01424 * R3H 3e-06 51.9 %
:HMM:PFM   151->207 PF01424 * R3H 7.8e-22 46.3 54/55  
:HMM:PFM   90->118 PF00013 * KH_1 7.4e-05 27.6 29/57  
:HMM:PFM   127->150 PF01749 * IBB 0.00096 45.8 24/97  
:BLT:SWISS 1->208 JAG_BACSU e-114 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB16140.1 GT:GENE jag GT:PRODUCT SpoIIIJ-associated RNA/ssDNA-binding protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(4213200..4213826) GB:FROM 4213200 GB:TO 4213826 GB:DIRECTION - GB:GENE jag GB:PRODUCT SpoIIIJ-associated RNA/ssDNA-binding protein GB:FUNCTION 16.3: Control GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12813085, 1487728; Product type f: factor GB:PROTEIN_ID CAB16140.1 GB:DB_XREF GOA:Q01620 InterPro:IPR001374 SubtiList:BG10061 UniProtKB/Swiss-Prot:Q01620 GB:GENE:GENE jag LENGTH 208 SQ:AASEQ MRNVTAAGRNVDEAVQSGLQELGLTKDKVEITVIEEGNKGFLGIFGKKPAIVKLVEKIDPIQQAKLYLQTIAEAIAGKSDVTVQESKKTVRYHITGEKAALLIGKRGQTLNALETLTQLALNRYPGQYKNVTVDAENYRLKRKETLSQLAIKLADQVLKTKKSIQLEPMPSSERKIIHDTLSGYANHQIKTYSMGEGENRHLVISHKR GT:EXON 1|1-208:0| SW:ID JAG_BACSU SW:DE RecName: Full=Protein jag;AltName: Full=SpoIIIJ-associated protein; SW:GN Name=jag; OrderedLocusNames=BSU41030; SW:KW Complete proteome; RNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->208|JAG_BACSU|e-114|100.0|208/208| GO:SWS:NREP 1 GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| BL:PDB:NREP 1 BL:PDB:REP 19->208|3gkuA|7e-29|41.8|182/199| RP:PDB:NREP 2 RP:PDB:REP 74->117|2cpqA|2e-04|13.6|44/91| RP:PDB:REP 135->208|2cpmA|3e-14|19.7|71/94| RP:PFM:NREP 1 RP:PFM:REP 149->205|PF01424|3e-06|51.9|54/56|R3H| HM:PFM:NREP 3 HM:PFM:REP 151->207|PF01424|7.8e-22|46.3|54/55|R3H| HM:PFM:REP 90->118|PF00013|7.4e-05|27.6|29/57|KH_1| HM:PFM:REP 127->150|PF01749|0.00096|45.8|24/97|IBB| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01424|IPR001374| RP:SCP:NREP 1 RP:SCP:REP 146->207|1mszA|3e-09|20.3|59/62|d.68.7.1| HM:SCP:REP 145->208|1mszA_|3.6e-09|31.1|61/0|d.68.7.1|1/1|R3H domain| OP:NHOMO 253 OP:NHOMOORG 253 OP:PATTERN -------------------------------------------------------------------- ---11---------1-------1111-----11---11111--111--1---111-1---1-1111-1111111111111111-----------------------------------------------------1111111111--1-------------------1--------------1111111111111111111111111111111111111111--111111111-------------------1-1-11-1---11111111----111111111111111111111111111111111-111111111111111111111111111111111111111-11111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11-1-1111---------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111-------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 90.9 SQ:SECSTR ##################HHHHTccGGGEEEEEEEccccccccEETcccEEEEEEEcccHHHHHHHHHHHHHHccccccccccccccEEEEEEccHHHHHHHHTTTTHHHHHHHTcTHHHHHHTcccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHTT#HHHTcEEEEEcccccccEEEEEcc PSIPRED ccEEEEEEccHHHHHHHHHHHHcccHHEEEEEEEEEccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEcc //