[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : kapD
DDBJ      :kapD         putative exoribonuclease (3'-5')
Swiss-Prot:KAPD_BACSU   RecName: Full=Probable 3'-5' exonuclease kapD;         EC=3.1.-.-;

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->166 1zbuB PDBj 2e-14 36.3 %
:RPS:PDB   6->205 3cg7B PDBj 2e-16 22.1 %
:RPS:SCOP  4->166 1w0hA  c.55.3.5 * 7e-45 34.2 %
:HMM:SCOP  4->189 1w0hA_ c.55.3.5 * 1.3e-24 22.3 %
:RPS:PFM   28->172 PF00929 * Exonuc_X-T 7e-05 26.2 %
:HMM:PFM   6->173 PF00929 * Exonuc_X-T 1.4e-27 28.0 157/165  
:BLT:SWISS 1->205 KAPD_BACSU e-120 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB15136.1 GT:GENE kapD GT:PRODUCT putative exoribonuclease (3'-5') GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(3231812..3232429) GB:FROM 3231812 GB:TO 3232429 GB:DIRECTION - GB:GENE kapD GB:PRODUCT putative exoribonuclease (3'-5') GB:FUNCTION 16.5: Explore 16.3: Control GB:NOTE Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe: putative enzyme GB:PROTEIN_ID CAB15136.1 GB:DB_XREF GOA:O05231 InterPro:IPR006055 SubtiList:BG12358 UniProtKB/Swiss-Prot:O05231 GB:GENE:GENE kapD LENGTH 205 SQ:AASEQ MTTNSLLIIDFEFTMPDGKYSPQNFFPEIIEAGIVKSIDDEVVETFSSYVRPKKFPKLTKRCKSFLKITQKQVDEGMRFEDFIRKLNELDPEKNSTIITWGNMDMKVLKQNCMFNHIPFPFKGEMRDLSLEYKNFFGDRTLTGLWKAAEEYGDSGTGTHHKALDDALTAYKLFKLVEQDKQYLEKPKPPTIGERIDLTELLKRAT GT:EXON 1|1-205:0| SW:ID KAPD_BACSU SW:DE RecName: Full=Probable 3'-5' exonuclease kapD; EC=3.1.-.-; SW:GN Name=kapD; Synonyms=yugB; OrderedLocusNames=BSU31470; SW:KW Complete proteome; Exonuclease; Hydrolase; Magnesium; Metal-binding;Nuclease; Sporulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->205|KAPD_BACSU|e-120|100.0|205/205| GO:SWS:NREP 5 GO:SWS GO:0004527|"GO:exonuclease activity"|Exonuclease| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004518|"GO:nuclease activity"|Nuclease| GO:SWS GO:0030435|"GO:sporulation resulting in formation of a cellular spore"|Sporulation| BL:PDB:NREP 1 BL:PDB:REP 6->166|1zbuB|2e-14|36.3|157/294| RP:PDB:NREP 1 RP:PDB:REP 6->205|3cg7B|2e-16|22.1|195/295| RP:PFM:NREP 1 RP:PFM:REP 28->172|PF00929|7e-05|26.2|141/163|Exonuc_X-T| HM:PFM:NREP 1 HM:PFM:REP 6->173|PF00929|1.4e-27|28.0|157/165|Exonuc_X-T| RP:SCP:NREP 1 RP:SCP:REP 4->166|1w0hA|7e-45|34.2|161/200|c.55.3.5| HM:SCP:REP 4->189|1w0hA_|1.3e-24|22.3|184/0|c.55.3.5|1/1|Ribonuclease H-like| OP:NHOMO 127 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------1--------------------------------------------3--------------------1-1-----------------------1111111111111111--1111111-11-------------------------------------------------------------------------------------------------------1-----------------1-----1---1---11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------1--1-------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1--------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------31312111111111421--562-412---21-11--2-2-1-1211112----21------2411-----------232--1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 100.0 SQ:SECSTR HHHcEEEEEEEEEcccTTccccccccccEEEEEEEEEETTTEEEEEEEEccccccccccHHHHHHHcccHHHHHTcccHHHHHHTHHTTccTTcEEEEEcccHHHHTHHHHHHTccccGGGcEEEEHHHHHHHHHHHHccccHHHHHHHHHTccccccTTcHHHHHHHHHHHHHHHHHTTccccccEEEEcccGGGGccccccTT DISOP:02AL 204-205| PSIPRED cccccEEEEEEEEcccccccccccccccEEEEEEEEEEccEEEEEEEEEccccccccccHHHHHHccccHHHHHccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccc //