[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : kdgA
DDBJ      :kdgA         2-keto-3-deoxygluconate-6-phosphate aldolase
Swiss-Prot:ALKH_BACSU   RecName: Full=KHG/KDPG aldolase;Includes:  RecName: Full=4-hydroxy-2-oxoglutarate aldolase;           EC=4.1.3.16;  AltName: Full=2-keto-4-hydroxyglutarate aldolase;           Short=KHG-aldolase;Includes:  RecName: Full=2-dehydro-3-deoxy-phosphogluconate aldolase;           EC=4.1.2.14;  AltName: Full=Phospho-2-dehydro-3-deoxygluconate aldolase;  AltName: Full=Phospho-2-keto-3-deoxygluconate aldolase;  AltName: Full=2-keto-3-deoxy-6-phosphogluconate aldolase;           Short=KDPG-aldolase;

Homologs  Archaea  5/68 : Bacteria  490/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->168 1wa3D PDBj 2e-30 36.8 %
:RPS:PDB   14->182 3ceuA PDBj 1e-10 13.3 %
:RPS:SCOP  6->182 1euaA  c.1.10.1 * 9e-38 31.6 %
:HMM:SCOP  1->182 1euaA_ c.1.10.1 * 3.5e-52 42.3 %
:RPS:PFM   10->182 PF01081 * Aldolase 3e-38 46.8 %
:HMM:PFM   6->196 PF01081 * Aldolase 2e-85 49.2 191/196  
:BLT:SWISS 1->196 ALKH_BACSU e-101 100.0 %
:PROS 125->138|PS00160|ALDOLASE_KDPG_KHG_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14127.1 GT:GENE kdgA GT:PRODUCT 2-keto-3-deoxygluconate-6-phosphate aldolase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2323009..2323599) GB:FROM 2323009 GB:TO 2323599 GB:DIRECTION - GB:GENE kdgA GB:PRODUCT 2-keto-3-deoxygluconate-6-phosphate aldolase GB:FUNCTION 16.11: Scavenge (Catabolism) 16.2: Construct biomass (Anabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 10368143, 9846747; Product type e: enzyme GB:PROTEIN_ID CAB14127.1 GB:DB_XREF GOA:P50846 HSSP:1EUA InterPro:IPR013785 SubtiList:BG11396 UniProtKB/Swiss-Prot:P50846 GB:GENE:GENE kdgA LENGTH 196 SQ:AASEQ MESKVVENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIESFRNREDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFGIPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGSQLGSCSKEDLQAVFQV GT:EXON 1|1-196:0| SW:ID ALKH_BACSU SW:DE RecName: Full=KHG/KDPG aldolase;Includes: RecName: Full=4-hydroxy-2-oxoglutarate aldolase; EC=4.1.3.16; AltName: Full=2-keto-4-hydroxyglutarate aldolase; Short=KHG-aldolase;Includes: RecName: Full=2-dehydro-3-deoxy-phosphogluconate aldolase; EC=4.1.2.14; AltName: Full=Phospho-2-dehydro-3-deoxygluconate aldolase; AltName: Full=Phospho-2-keto-3-deoxygluconate aldolase; AltName: Full=2-keto-3-deoxy-6-phosphogluconate aldolase; Short=KDPG-aldolase; SW:GN Name=kdgA; OrderedLocusNames=BSU22100; SW:KW Complete proteome; Cytoplasm; Lyase; Multifunctional enzyme;Schiff base. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->196|ALKH_BACSU|e-101|100.0|196/196| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| PROS 125->138|PS00160|ALDOLASE_KDPG_KHG_2|PDOC00144| SEG 74->86|aqqageaakagaq| BL:PDB:NREP 1 BL:PDB:REP 6->168|1wa3D|2e-30|36.8|163/203| RP:PDB:NREP 1 RP:PDB:REP 14->182|3ceuA|1e-10|13.3|158/193| RP:PFM:NREP 1 RP:PFM:REP 10->182|PF01081|3e-38|46.8|173/194|Aldolase| HM:PFM:NREP 1 HM:PFM:REP 6->196|PF01081|2e-85|49.2|191/196|Aldolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01081|IPR000887| GO:PFM GO:0008152|"GO:metabolic process"|PF01081|IPR000887| RP:SCP:NREP 1 RP:SCP:REP 6->182|1euaA|9e-38|31.6|177/213|c.1.10.1| HM:SCP:REP 1->182|1euaA_|3.5e-52|42.3|182/0|c.1.10.1|1/1|Aldolase| OP:NHOMO 751 OP:NHOMOORG 510 OP:PATTERN ------------------------1--1112------------------------------------- 1-1-2-----1--------------3------------341--2211-1---122--1--1--11121411-------2---1-----111111-----1-2-211-2-1-----------------------------------1111111-1111-1111111111111-11---------22-1111-1-1-------1-------212211----13-2-----1---2------------------113-1-22-----1---23------1112122222---111111211111111111211111-22---222211-231111111-1-21--11111--1--1------------124-1------2221-11-131121--------11221222122-1111111122--122222121111112112232133222--------1--11---------------------------------11211----12222222222222222222222221111--2221-111-1232111--1111-1111111-----------------------------------2-----------1-1-1111111-------1142111-3221211111111111111111-------------22111212112233222-12224232221323323333232111221222122212-111231111111--111111111111----1111111111-113111312-111--1111111111---4122221122111112222----------2244111111323522222221221111---1--------------11----1------1-------------------111-1-1- ------1-----------------------------------------------------------------------------------------------------3------------------------------------------------------2-----------1--11111--2--1--111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 90.3 SQ:SECSTR #####HHHHHHHHEEEEEccccccTTHHHHHHHHHHTTccEEEEcccHHHHHHHHHccGGGGGGEEEcccTTHHHHTTcEEEcccccccccTTcccEEHHHHHHTcEEEEEEccHHHHHTTGGGccEEEccccccccHHHHHHHHHHTTcccTTEEEccccTTTHHHHHHTTccEEEEcHHH############## DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccEEEcccccHHHHHHHHHccccEEcccccHHHHHHHHHccccEEEEcccHHccHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccEEEEEcHHHcHHHHHHHHHHHcc //