[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : kdgK
DDBJ      :kdgK         2-keto-3-deoxygluconate kinase
Swiss-Prot:KDGK_BACSU   RecName: Full=2-dehydro-3-deoxygluconokinase;         EC=2.7.1.45;AltName: Full=2-keto-3-deoxygluconokinase;AltName: Full=3-deoxy-2-oxo-D-gluconate kinase;AltName: Full=KDG kinase;

Homologs  Archaea  32/68 : Bacteria  481/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.72.1
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->311 1v19A PDBj 1e-39 36.4 %
:RPS:PDB   6->311 2dcnA PDBj 3e-46 27.8 %
:RPS:SCOP  6->312 2afbA1  c.72.1.1 * 8e-51 25.2 %
:HMM:SCOP  1->312 2afbA1 c.72.1.1 * 1.4e-83 36.5 %
:RPS:PFM   27->296 PF00294 * PfkB 2e-34 38.9 %
:HMM:PFM   5->303 PF00294 * PfkB 3e-72 36.5 288/300  
:BLT:SWISS 1->324 KDGK_BACSU 0.0 100.0 %
:PROS 255->268|PS00584|PFKB_KINASES_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB14128.1 GT:GENE kdgK GT:PRODUCT 2-keto-3-deoxygluconate kinase GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION complement(2323601..2324575) GB:FROM 2323601 GB:TO 2324575 GB:DIRECTION - GB:GENE kdgK GB:PRODUCT 2-keto-3-deoxygluconate kinase GB:FUNCTION 16.2: Construct biomass (Anabolism) 16.11: Scavenge (Catabolism) GB:NOTE Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 10368143, 15039578, 9846747; Product type e : enzyme GB:PROTEIN_ID CAB14128.1 GB:DB_XREF GOA:P50845 HSSP:1J5V InterPro:IPR002173 SubtiList:BG11397 UniProtKB/Swiss-Prot:P50845 GB:GENE:GENE kdgK LENGTH 324 SQ:AASEQ MKLDAVTFGESMAMFYANEYGGLHEVSTFSKGLAGAESNVACGLARLGFRMGWMSKVGNDQLGTFILQELKKEGVDVSRVIRSQDENPTGLLLKSKVKEGDPQVTYYRKNSAASTLTTAEYPRDYFQCAGHLHVTGIPPALSAEMKDFTYHVMNDMRNAGKTISFDPNVRPSLWPDQATMVHTINDLAGLADWFFPGIAEGELLTGEKTPEGIADYYLKKGASFVAIKLGKEGAYFKTGTSEGFLEGCRVDRVVDTVGAGDGFAVGVISGILDGLSYKDAVQRGNAIGALQVQAPGDMDGLPTREKLASFLSAQRTVHQKKGDY GT:EXON 1|1-324:0| SW:ID KDGK_BACSU SW:DE RecName: Full=2-dehydro-3-deoxygluconokinase; EC=2.7.1.45;AltName: Full=2-keto-3-deoxygluconokinase;AltName: Full=3-deoxy-2-oxo-D-gluconate kinase;AltName: Full=KDG kinase; SW:GN Name=kdgK; OrderedLocusNames=BSU22110; SW:KW ATP-binding; Complete proteome; Kinase; Nucleotide-binding;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->324|KDGK_BACSU|0.0|100.0|324/324| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 255->268|PS00584|PFKB_KINASES_2|PDOC00504| BL:PDB:NREP 1 BL:PDB:REP 3->311|1v19A|1e-39|36.4|291/301| RP:PDB:NREP 1 RP:PDB:REP 6->311|2dcnA|3e-46|27.8|299/308| RP:PFM:NREP 1 RP:PFM:REP 27->296|PF00294|2e-34|38.9|257/295|PfkB| HM:PFM:NREP 1 HM:PFM:REP 5->303|PF00294|3e-72|36.5|288/300|PfkB| RP:SCP:NREP 1 RP:SCP:REP 6->312|2afbA1|8e-51|25.2|302/326|c.72.1.1| HM:SCP:REP 1->312|2afbA1|1.4e-83|36.5|307/0|c.72.1.1|1/1|Ribokinase-like| OP:NHOMO 1170 OP:NHOMOORG 529 OP:PATTERN 221-1-111111111124-----1-111123--32------------------12321--1---1--- 113-41---------------1---2------1----1432---1111---1234--1112-221233411-----------3-----112311-----1---12--2-------------------------------23---12-212111--1111-----1111112------------1111123-213222221-3-21-1--33332322--24121111111-3312222222222222222221213--1-2---11222211111111-1111111---------1-----------1------11---111213-37111111121321--13532112--22--1-----3--223-31----1-11------3-121---1----22121311115---2--1-134--555352765544121111242133343--------211------------------------------------11------14554444433344334444445432121--2243----232223-------------------------------------1-1------1111111----------------------------1131-4--5122111--11112-1-1--2--------------54342344445456544-4444546454444444443666344224123213112334333454233421-433333323333---11111111111-235222624-122-3331----------411111-43311111-324-----------2261111133323-111111111-------2--------------1-1-------------111---------2321123222--1 ---------------------1----------------------------------------1----1------------------------------------------1-----------1----1----------------------------1-2-----------1------------2-8357-74------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 100.0 SQ:SECSTR cccEEEEEcccEEEEEEcccccGGGcccEEEEEEcHHHHHHHHHHHTTcEEEEEcEEEccHHHHHHHHHHHHTTcccTTcEEETTcccccEEEEEEccccTTcEEEEcTTcTGGGccGGGccHHHHTTccEEEEEHHHHHccHHHHHHHHHHHHHHHHHcccEEEEccccTTTccHHHHHHHHHHHHHHcEEEEEEEHHHHHHHHcccccHHHHHHHHTTTEEEEEEEEETTEEEEEETTEEEEEEccccccccccTTHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHTTcccccTTcccHHHHHHHHHHccccHHHHccE DISOP:02AL 317-324| PSIPRED ccEEEEEEccEEEEEEccccccEEEcccEEEEccccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHccccccEEEEccccccEEEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHccEEEEcHHHHHHHHccccHHHHHHHHHHccccEEEEEEccccEEEEEcccEEEEccccccEEcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccc //