[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacillus subtilis subsp. subtilis str. 168 (bsub0)
Gene : ktrC
DDBJ      :ktrC         potassium uptake protein
Swiss-Prot:KTRC_BACSU   RecName: Full=Ktr system potassium uptake protein C;         Short=K(+)-uptake protein ktrC;AltName: Full=ORF4;

Homologs  Archaea  29/68 : Bacteria  397/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.286.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->140 2hmtA PDBj 1e-46 63.8 %
:RPS:PDB   1->48 1dv2B PDBj 9e-06 18.8 %
:RPS:PDB   47->216 2bkoA PDBj 8e-25 20.2 %
:RPS:SCOP  1->141 1id1A  c.2.1.9 * 3e-14 17.9 %
:RPS:SCOP  136->216 1vctA2  d.286.1.1 * 3e-16 30.9 %
:HMM:SCOP  3->136 1lsuA_ c.2.1.9 * 1.7e-37 35.8 %
:HMM:SCOP  130->217 2fy8A2 d.286.1.1 * 1.3e-21 40.9 %
:RPS:PFM   7->118 PF02254 * TrkA_N 1e-09 32.4 %
:RPS:PFM   149->215 PF02080 * TrkA_C 5e-12 43.9 %
:HMM:PFM   5->120 PF02254 * TrkA_N 8.5e-32 40.0 115/116  
:HMM:PFM   150->216 PF02080 * TrkA_C 5.5e-18 34.8 66/71  
:BLT:SWISS 1->221 KTRC_BACSU e-121 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID CAB13324.1 GT:GENE ktrC GT:PRODUCT potassium uptake protein GT:DATABASE GIB00011CH01 GT:ORG bsub0 GB:ACCESSION GIB00011CH01 GB:LOCATION 1520531..1521196 GB:FROM 1520531 GB:TO 1521196 GB:DIRECTION + GB:GENE ktrC GB:PRODUCT potassium uptake protein GB:FUNCTION 16.1: Circulate GB:NOTE Evidence 1a: Function experimentally demonstrated in the studied strain; PubMedId: 12562800, 15096624; Product type t: transporter GB:PROTEIN_ID CAB13324.1 GB:DB_XREF GOA:P39760 HSSP:1LSU InterPro:IPR003148 SubtiList:BG10991 UniProtKB/Swiss-Prot:P39760 GB:GENE:GENE ktrC LENGTH 221 SQ:AASEQ MKKEFAVIGLGRFGGSICKALSEEGVEVMAMDIDEDKVNEYAKIASHAVIGDSTDESVLKNLGLRNFDHVIVAIGENIQASILTTLILKELGVHTITVKAQNDYHEKVLSKIGADHIVHPERDMAKRIAHNIVSNNVLDYLELSEEHSLVEIVANSRLAGNTLLDLDIRAKYGINIVAIKRGKEVIVSPLATEVIHQEDILIVIGSVTDISRFEKRVLHTK GT:EXON 1|1-221:0| SW:ID KTRC_BACSU SW:DE RecName: Full=Ktr system potassium uptake protein C; Short=K(+)-uptake protein ktrC;AltName: Full=ORF4; SW:GN Name=ktrC; Synonyms=ykqB, ylxV, yzaC; OrderedLocusNames=BSU14510; SW:KW Cell membrane; Complete proteome; Ion transport; Membrane; NAD;Potassium; Potassium transport; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->221|KTRC_BACSU|e-121|100.0|221/221| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006813|"GO:potassium ion transport"|Potassium transport| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 3->140|2hmtA|1e-46|63.8|138/139| RP:PDB:NREP 2 RP:PDB:REP 1->48|1dv2B|9e-06|18.8|48/448| RP:PDB:REP 47->216|2bkoA|8e-25|20.2|163/190| RP:PFM:NREP 2 RP:PFM:REP 7->118|PF02254|1e-09|32.4|111/116|TrkA_N| RP:PFM:REP 149->215|PF02080|5e-12|43.9|66/71|TrkA_C| HM:PFM:NREP 2 HM:PFM:REP 5->120|PF02254|8.5e-32|40.0|115/116|TrkA_N| HM:PFM:REP 150->216|PF02080|5.5e-18|34.8|66/71|TrkA_C| GO:PFM:NREP 3 GO:PFM GO:0006813|"GO:potassium ion transport"|PF02254|IPR003148| GO:PFM GO:0006813|"GO:potassium ion transport"|PF02080|IPR006037| GO:PFM GO:0008324|"GO:cation transmembrane transporter activity"|PF02080|IPR006037| RP:SCP:NREP 2 RP:SCP:REP 1->141|1id1A|3e-14|17.9|140/153|c.2.1.9| RP:SCP:REP 136->216|1vctA2|3e-16|30.9|81/94|d.286.1.1| HM:SCP:REP 3->136|1lsuA_|1.7e-37|35.8|134/134|c.2.1.9|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 130->217|2fy8A2|1.3e-21|40.9|88/0|d.286.1.1|1/1|TrkA C-terminal domain-like| OP:NHOMO 545 OP:NHOMOORG 426 OP:PATTERN ---1-------------------12113131-1-132222111-----1-131111-111-------- -21--11----111-------------------1112-11----11111111111221--11---11---11111-11----11----1111-2--1---1--1----2----------------11-------22111111---12213212222211111122131111111111111111211-111--2211212212222222223221222211122111111111211111111111111111111111----1---1111---1-11----11111111--2222222222211111111111111111111111-43--2212222121-111111122131212121111111111111-121-21---------------------------------------1------------------------1----------------------1--------------------------------1------------------------------------------------1---11-----------------21--4211243123222111111-131--1--1121--1-111111-1-------11-1---11----11----1111---1111-2--1----------------------------------------------------------------------------------------------------------------1-11------------11-1111111111----------1----1-------------1111-----12111----------------2111111111111111221----1-1111111111111111----11-1111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 217 STR:RPRED 98.2 SQ:SECSTR cccEEEEEcccHHHHHHHHHcTTcEEEEEEccGGGHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHcccEEEEccTTcTTTTccHHHHTHHHHHccEEEEEEETTEEEEcccTTccccTTcEEEEEEcHHHHHHHHHHH#### PSIPRED ccccEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccEEEEEccccHHHHHHccHHcccEEEEccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEEccEEEEEEEEccHHHccccHHHHcccccccEEEEEEEEccEEEEccccccEEccccEEEEEEcHHHHHHHHHHHcccc //